KEGG   Pan troglodytes (chimpanzee): 471869Help
Entry
471869            CDS       T01005                                 

Gene name
HIST1H2BA
Definition
histone cluster 1, H2ba
Orthology
K11252  
histone H2B
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Alcoholism
Viral carcinogenesis
Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    471869 (HIST1H2BA)
  Immune diseases
   05322 Systemic lupus erythematosus
    471869 (HIST1H2BA)
  Substance dependence
   05034 Alcoholism
    471869 (HIST1H2BA)
Exosome [BR:ptr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   471869 (HIST1H2BA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
6
AA seq 127 aa AA seqDB search
MPEVSSKGATISKKGFKKAVVKTQKKEGKKRKRTRKESYSIYIYKVLKQVHPDTGISSKA
MSIMNSFVTDIFERIASEASRLAHYSKRSTISSREIQTAVRLLLPGELAKHAVSEGTKAV
TKYTSSK
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgccggaggtgtcgtctaaaggtgctaccatttccaagaagggctttaagaaagctgtc
gttaagacccagaagaaggagggcaaaaagcgcaagaggacccgtaaggagagttattct
atttacatctacaaggtgctaaagcaggtccatccggacactgggatctcttcgaaagcc
atgagcattatgaattccttcgtcactgatatctttgagcgtatagcgagcgaggcatca
cgtttggctcactacagcaagcgctccaccatctcttccagagagattcagacagcagtg
cgcttgctactgccgggagagctggctaaacatgctgtgtctgagggcaccaaggctgtc
actaagtacaccagctccaaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system