KEGG   Pan troglodytes (chimpanzee): 471869Help
Entry
471869            CDS       T01005                                 

Gene name
HIST1H2BA
Definition
histone cluster 1, H2ba
Orthology
K11252  
histone H2B
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Alcoholism
Viral carcinogenesis
Systemic lupus erythematosus
Class
Human Diseases; Cancers; Viral carcinogenesis [PATH:ptr05203]
Human Diseases; Immune diseases; Systemic lupus erythematosus [PATH:ptr05322]
Human Diseases; Substance dependence; Alcoholism [PATH:ptr05034]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
6
AA seq 127 aa AA seqDB search
MPEVSSKGATISKKGFKKAVVKTQKKEGKKRKRTRKESYSIYIYKVLKQVHPDTGISSKA
MSIMNSFVTDIFERIASEASRLAHYSKRSTISSREIQTAVRLLLPGELAKHAVSEGTKAV
TKYTSSK
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgccggaggtgtcgtctaaaggtgctaccatttccaagaagggctttaagaaagctgtc
gttaagacccagaagaaggagggcaaaaagcgcaagaggacccgtaaggagagttattct
atttacatctacaaggtgctaaagcaggtccatccggacactgggatctcttcgaaagcc
atgagcattatgaattccttcgtcactgatatctttgagcgtatagcgagcgaggcatca
cgtttggctcactacagcaagcgctccaccatctcttccagagagattcagacagcagtg
cgcttgctactgccgggagagctggctaaacatgctgtgtctgagggcaccaaggctgtc
actaagtacaccagctccaaataa

DBGET integrated database retrieval system