KEGG   Pan troglodytes (chimpanzee): 471972Help
Entry
471972            CDS       T01005                                 

Gene name
CYP21A2
Definition
(RefSeq) steroid 21-hydroxylase
  KO
K00513  
steroid 21-monooxygenase [EC:1.14.14.16]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Steroid hormone biosynthesis
Metabolic pathways
Aldosterone synthesis and secretion
Module
C21-Steroid hormone biosynthesis, progesterone => cortisol/cortisone
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    471972 (CYP21A2)
 Organismal Systems
  Endocrine system
   04925 Aldosterone synthesis and secretion
    471972 (CYP21A2)
Enzymes [BR:ptr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.16  steroid 21-monooxygenase
     471972 (CYP21A2)
Cytochrome P450 [BR:ptr00199]
 Cytochrome P450, animal type
  CYP21 family
   471972 (CYP21A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 306 aa AA seqDB search
MLLLGLLLLLPLLAGARLLWNWWKLRSLHLPPLAPGFLHLLQPDLPIYLLGLTQKFGPIY
RLHLGLQDVVVLNSKRTIEEAMVKKWADFAGRPEPLTYKLVSKNYPDLSLGDYSLLWKAH
KKLTRSALLLGIRDSMEPVVEQLTQEFCERMRAQPGTPVAIEEEFSLLTCSIICYLTFGD
KIKEDNLMPAYYKCIQEVLKTWSHWSIQIVDVIPFLRFFPNPGLRRLKQAIEKRDHIVEK
QLRQHKVGTVCGRPVRLQQVQEARGKRREVEAPELPPVPQQAGASQQGQQQQQAQEQHGE
TPVRAL
NT seq 920 nt NT seq  +upstreamnt  +downstreamnt
atgctgctcctgggcctgctgctgctgctgcccctgctggctggcgcccgcctgctgtgg
aactggtggaagctccggagcctccacctcccgcctcttgccccgggcttcttgcacctg
ctgcagcctgacctccccatctatctgcttggcctgactcagaaattcgggcccatctac
aggctccaccttgggctgcaagatgtggtggtgctgaactccaagaggaccattgaggaa
gccatggtcaaaaagtgggcagactttgctggcagacctgagccacttacctacaagctg
gtgtctaagaactacccggacctgtccttgggagactactccctgctctggaaagcccac
aagaagctcacccgctcagccctgctgctgggcatccgtgactccatggagccagtggtg
gagcagctgacccaggagttctgcgagcgcatgagagcccagcccggcacccctgtggcc
attgaggaggaattctctctccttacctgcagcatcatctgttacctcaccttcggagac
aagatcaaggaggacaacttaatgcctgcctattacaaatgtatccaggaggtgttaaaa
acctggagccactggtccatccaaattgtggacgtgattccctttctcaggttcttcccc
aatccaggtctccggaggctgaagcaggccatagagaagagggaccacatcgtggagaag
cagctgaggcagcacaaggtggggactgtgtgtggacggcctgtcaggctgcagcaggtg
caagaagcccggggcaagaggcgggaggtggaggctccggagcttccaccagttccacag
caggcgggcgccagccagcaggggcagcagcagcagcaggcccaggagcagcatggcgag
acgcccgtcagggccctgag

DBGET integrated database retrieval system