KEGG   Pan troglodytes (chimpanzee): 472269Help
Entry
472269            CDS       T01005                                 

Gene name
EIF3B, EIF3S9
Definition
eukaryotic translation initiation factor 3, subunit B
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:ptr03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
7
AA seq 814 aa AA seqDB search
MQDAENVAVPEAAEERAEPGQQQPAAEPPPAEGLLRPAGPGAPEAAGTEASGEEVGVAEA
GPEPEVRTEPAAEAEAASGPSESPSPPAAEEPPGSHAEPRVPAQGEAPGEQARNERSDSR
AQAVSEDAGGNEGRAAEAEPRALENGDADEPSFSDPEDFVDDVSEEELLGDVLKDRPQEA
DGIDSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKITNDFYPEEDGKTKGYIFLEYASP
AHAVDAVKNADGYKLDKQHTFRVNLFTDFDKYMTISDEWDIPEKQPFKDLGNLRYWLEEA
ECRDQYSVIFESGDRTSIFWNDVKDPVSIEERARWTETYVRWSPKGTYLATFHQRGIALW
GGEKFKQIQRFSHQGVQLIDFSPCERYLVTFSPLMDTQDDPQAIIIWDILTGHKKRGFHC
ESSAHWPIFKWSHDGKFFARMTLDTLSIYETPSMGLLDKKSLKISGIKDFSWSPGGNIIA
FWVPEDKDIPARVTLMQLPTRQEIRVRNLFNVVDCKLHWQKNGDYLCVKVDRTPKGTQGV
VTNFEIFRMREKQVPVDVVEMKETIIAFAWEPNGSKFAVLHGEAPRISVSFYHVKNNGKI
ELIKMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYMASDVEWD
PTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPPTLLSQEQIKQI
KKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKYRKMAQELYMEQKNERLELRG
GVDTDELDSNVDDWEEETIEFFVTEEIIPLGNQE
NT seq 2445 nt NT seq  +upstreamnt  +downstreamnt
atgcaggacgcagagaacgtggcggtgcccgaggcggccgaggagcgcgccgagcccggc
cagcagcagccggccgccgagccgccgccagccgaggggctgctgcggcccgcggggccc
ggcgctccggaggccgcggggaccgaggcctccggtgaggaggtgggggtcgcggaggcc
gggccggagcccgaggtgaggaccgagccggcggccgaggcagaggcggcctccggcccg
tccgagtcgccctcgccgccggccgccgaggagccgcccgggtcgcatgctgagccccgt
gtcccggcacagggcgaggccccaggagagcaggctcggaacgagcgctccgacagccgg
gcccaggcggtgtccgaggacgcgggaggaaacgagggcagagcggccgaggccgaaccc
cgggcgctggagaacggcgacgcggacgagccctccttcagcgaccccgaggacttcgtg
gacgacgtgagcgaggaagaattactgggagatgtactcaaagatcggccccaggaagca
gatggaatcgattcggtgattgtagtggacaatgtccctcaggtgggacccgaccgactt
gagaaactcaaaaatgtcatccacaagatcttttccaagtttgggaaaatcacaaatgat
ttttatcctgaagaggatgggaagacaaaagggtatattttcctggagtacgcgtcccct
gcccacgctgtggatgccgtgaagaatgccgacggctacaagcttgacaagcagcacaca
ttccgggtcaacctcttcacggattttgacaagtatatgaccatcagtgatgagtgggat
attccagagaaacagcctttcaaagacctggggaacttacgttactggcttgaagaggca
gaatgcagagatcagtacagtgtgatttttgagagtggagaccgcacttccatattctgg
aatgacgtaaaagaccctgtctcaattgaagagagagcgagatggacagagacgtatgtg
cgttggtctcctaagggcacctacctggctacctttcatcaaagaggcattgctctatgg
gggggagagaaattcaagcaaattcagagattcagccaccaaggggtccagcttattgac
ttctcaccttgtgaaaggtacctggtgacctttagccccctgatggacacgcaggatgac
cctcaggccataatcatctgggacatccttacggggcacaagaagaggggttttcactgt
gagagctcagcccattggcctatttttaagtggagccatgatggcaaattctttgccaga
atgaccctggatacgcttagcatctatgaaactccttctatgggtcttttggacaagaag
agtttgaagatctctgggataaaagacttttcttggtctcctggtggtaacataatcgcc
ttctgggtgcctgaagacaaagatattccagccagggtaaccctgatgcagctccctacc
aggcaagagatccgagtgaggaacctgttcaatgtggtggactgcaagctccattggcag
aagaacggagactacttgtgtgtgaaagtagataggactccgaaaggcacccagggtgtt
gtcacaaattttgaaattttccgaatgagggagaaacaggtacctgtggatgtggtcgag
atgaaagaaaccatcatagcctttgcctgggaaccaaatggaagtaagtttgctgtgctg
cacggagaggctccgcggatatctgtgtctttctaccacgtcaaaaacaacgggaagatt
gaactcatcaagatgttcgacaagcagcaggcgaacaccatcttctggagcccccaagga
cagttcgtggtgttggcgggcctgaggagtatgaacggtgccttagcgtttgtggacact
tcggactgcacggtcatgaacatcgcagagcactacatggcttccgacgtcgaatgggat
cctactgggcgctacgtcgtcacctctgtgtcctggtggagccataaggtggacaacgcg
tactggctgtggactttccagggacgcctcctgcagaagaacaacaaggaccgcttctgc
cagctgctgtggcggccccggcctcccacactcctgagccaggaacagatcaagcaaatt
aaaaaggatctgaagaaatactctaagatctttgaacagaaggatcgtttgagtcagtcc
aaagcctcaaaggaattggtggagagaaggcgcaccatgatggaagatttccggaagtac
cgaaaaatggcccaggagctctatatggagcagaaaaacgagcgcctggagttgcgagga
ggggtggacactgacgagctggacagcaacgtggacgactgggaagaggagaccattgag
ttcttcgtcactgaagaaatcatccccctcgggaatcaggagtga

DBGET integrated database retrieval system