KEGG   Pan troglodytes (chimpanzee): 472288Help
Entry
472288            CDS       T01005                                 

Gene name
C1GALT1
Definition
core 1 synthase, glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1
Orthology
K00731  
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase [EC:2.4.1.122]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Mucin type O-Glycan biosynthesis
Metabolic pathways
Module
O-glycan biosynthesis, mucin type core
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    472288 (C1GALT1)
Enzymes [BR:ptr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.122  glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase
     472288 (C1GALT1)
Glycosyltransferases [BR:ptr01003]
 Glycan extension
  Type 3 chain
   472288 (C1GALT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 371 aa AA seqDB search
MSEIHFREMASKSWLNFLTFLCGSAIGFLLCSQLFSILLGEKGDTQPNVLHNDPHARHSD
DNGQNHLEGQMNFNADSSQHKDENTDIAENLYHKVRILCWVMTGPQNLEKKAKHVKATWA
QRCNKVLFMSSEENKDFPAVGLKTKEGRDQLYWKTIKAFQYVHEHYLEDADWFLKADDDT
YVILDNLRWLLSKYDPEEPIYFGRRFKPYVKQGYMSGGAGYVLSKEALKRFVDAFKTDKC
THSSSIEDLALGRCMEIMNVEAGDSRDTIGKETFHPFVPEHHLIKGYLPRTFWYWNYNYY
PPVEGPGCCSDLAVSFHYVDSTTMYELEYLVYHLRPYGYLYRYQPTLPEHILKEISQANK
NEDTKVKLGNP
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaaatacactttcgggaaatggcctctaaatcctggctgaattttttaaccttc
ctctgtggatcagcaataggatttcttttatgttctcagctatttagtattttgttggga
gaaaagggtgacacccagcctaatgttcttcataatgatcctcatgcaaggcattcagat
gataatggacagaatcatctagaaggacaaatgaacttcaatgcagattctagccaacat
aaagatgagaacacagacattgctgaaaacctctatcacaaagttagaattctttgctgg
gttatgaccggccctcaaaacctagagaaaaaggccaaacacgtcaaagctacttgggcc
cagcgttgtaacaaagtgttgtttatgagttcagaagaaaataaagacttccctgctgtg
ggattgaaaaccaaagaaggcagagatcaactatactggaaaacaattaaagcttttcag
tatgttcatgaacattatttagaagatgctgattggtttttgaaagcagatgatgacacg
tatgtcatactagacaatttgaggtggcttctttcaaaatacgaccctgaagaacccatt
tactttgggaggagatttaagccttatgtaaagcagggctacatgagtggaggagcagga
tatgtactaagcaaagaagccttgaaaagatttgttgacgcatttaaaacagacaagtgt
acacatagttcctccattgaagacttagcactggggagatgcatggaaattatgaatgta
gaagcaggagattccagagataccattggaaaagaaacttttcatccctttgtgccagaa
caccatttaattaaaggttatctacctagaacgttttggtactggaattacaactattat
cctcctgtagagggtcctggttgctgttctgatcttgcagtttcttttcactatgttgat
tctacaaccatgtatgagttagaatacctcgtttatcatcttcgtccatatggttattta
tacagatatcaacctaccttacctgaacatatactaaaggaaattagtcaagcaaacaaa
aatgaagatacaaaagtgaagttaggaaatccttga

DBGET integrated database retrieval system