KEGG   Pan troglodytes (chimpanzee): 472448Help
Entry
472448            CDS       T01005                                 

Gene name
PDK4
Definition
(RefSeq) pyruvate dehydrogenase kinase 4
  KO
K00898  pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
ptr  Pan troglodytes (chimpanzee)
Brite
Enzymes [BR:ptr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     472448 (PDK4)
Protein kinases [BR:ptr01001]
 Serine/threonine kinases: Other
  PDHK family [OT]
   472448 (PDK4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BCDHK_Adom3 HATPase_c HATPase_c_3 Adaptin_N
Motif
Other DBs
NCBI-GeneID: 472448
NCBI-ProteinID: NP_001233460
Ensembl: ENSPTRG00000019421
UniProt: G2HER8
Position
7
AA seq 411 aa AA seqDB search
MKAARFVLRSAGSLNGAGLVPREVEHFSRYSPSPLSMKQLLDFGSENACERTSFAFLRQE
LPVRLANILKEIDILPTQLVNTSSVQLVKSWYIQSLMDLVEFHEKSPDDQKALSDFVDTL
IKVRNRHHNVVPTMAQGIIEYKDACTVDPVTNQNLQYFLDRFYMNRISTRMLMNQHILIF
SDSQTGNPSHIGSIDPNCDVVAVVQDAFECSRMLCDQYYLTSPELKLTQVNGKFPDQPIH
IVYVPSHLHHMLFELFKNAMRATVEHQENQPSLTPIEVIVVLGKEDLTIKISDRGGGVPL
RIIDRLFSYTYSTAPTPVMDNSRNAPLAGFGYGLPISRLYAKYFQGDLNLYSLSGYGTDA
IIYLKALSSESIEKLPVFNKSAFKHYQMSSEADDWCIPSREPKNLAKEVAM
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcggcccgcttcgtgctgcgcagcgctggctcgctcaacggcgccggcctggtg
ccccgagaggtggagcatttctcgcgctacagcccgtccccgctgtccatgaagcagcta
ctggactttggttcagaaaatgcatgtgaaagaacttcttttgcatttttgcgacaagaa
ttgcctgtgagactcgccaacattctgaaggaaattgatatcctcccgacccaattagta
aatacctcttcagtgcaattggttaaaagctggtatatacagagcctgatggatttggtg
gaattccatgagaaaagcccagatgaccagaaagcattatcagactttgtagatacactt
atcaaagttcgaaatagacaccataatgtagtccctacaatggcacaaggaatcatagag
tataaagatgcctgtacagttgacccagtcaccaatcaaaatcttcaatatttcttggat
cgattttacatgaaccgtatttctactcggatgctgatgaaccagcacattcttatattt
agtgactcacagacaggaaacccaagccacattggaagcattgatcctaactgtgatgtg
gtagcagtggtccaagatgcctttgagtgttcaaggatgctctgtgatcagtattattta
acatctccagaattaaagcttacacaagtgaatggaaaatttccagaccaaccaattcac
attgtgtatgttccttctcacctccatcatatgctctttgaactatttaagaatgcaatg
cgggcaacagttgaacaccaggaaaatcagccttcccttacaccaatagaggttattgtt
gtcttgggaaaagaagaccttaccattaagatttcagacagaggaggtggtgttcccctg
agaattattgaccgcctctttagttatacatactccactgcaccaacgcctgtgatggat
aattcccggaatgctcctttggctggttttggttacggcttgccaatttctcgtctgtat
gccaagtactttcaaggagatctgaatctctactctttatcaggatatggaacagatgct
atcatctacttaaaggctttgtcttctgagtctatagaaaaacttccagtttttaacaag
tcagccttcaaacattatcagatgagctctgaggcggatgactggtgtatcccaagcagg
gaaccaaagaacctggcaaaagaagtggccatgtga

DBGET integrated database retrieval system