KEGG   Pan troglodytes (chimpanzee): 472448Help
Entry
472448            CDS       T01005                                 

Gene name
PDK4
Definition
pyruvate dehydrogenase kinase, isozyme 4 (EC:2.7.11.2)
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
ptr  Pan troglodytes (chimpanzee)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 411 aa AA seqDB search
MKAARFVLRSAGSLNGAGLVPREVEHFSRYSPSPLSMKQLLDFGSENACERTSFAFLRQE
LPVRLANILKEIDILPTQLVNTSSVQLVKSWYIQSLMDLVEFHEKSPDDQKALSDFVDTL
IKVRNRHHNVVPTMAQGIIEYKDACTVDPVTNQNLQYFLDRFYMNRISTRMLMNQHILIF
SDSQTGNPSHIGSIDPNCDVVAVVQDAFECSRMLCDQYYLTSPELKLTQVNGKFPDQPIH
IVYVPSHLHHMLFELFKNAMRATVEHQENQPSLTPIEVIVVLGKEDLTIKISDRGGGVPL
RIIDRLFSYTYSTAPTPVMDNSRNAPLAGFGYGLPISRLYAKYFQGDLNLYSLSGYGTDA
IIYLKALSSESIEKLPVFNKSAFKHYQMSSEADDWCIPSREPKNLAKEVAM
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcggcccgcttcgtgctgcgcagcgctggctcgctcaacggcgccggcctggtg
ccccgagaggtggagcatttctcgcgctacagcccgtccccgctgtccatgaagcagcta
ctggactttggttcagaaaatgcatgtgaaagaacttcttttgcatttttgcgacaagaa
ttgcctgtgagactcgccaacattctgaaggaaattgatatcctcccgacccaattagta
aatacctcttcagtgcaattggttaaaagctggtatatacagagcctgatggatttggtg
gaattccatgagaaaagcccagatgaccagaaagcattatcagactttgtagatacactt
atcaaagttcgaaatagacaccataatgtagtccctacaatggcacaaggaatcatagag
tataaagatgcctgtacagttgacccagtcaccaatcaaaatcttcaatatttcttggat
cgattttacatgaaccgtatttctactcggatgctgatgaaccagcacattcttatattt
agtgactcacagacaggaaacccaagccacattggaagcattgatcctaactgtgatgtg
gtagcagtggtccaagatgcctttgagtgttcaaggatgctctgtgatcagtattattta
acatctccagaattaaagcttacacaagtgaatggaaaatttccagaccaaccaattcac
attgtgtatgttccttctcacctccatcatatgctctttgaactatttaagaatgcaatg
cgggcaacagttgaacaccaggaaaatcagccttcccttacaccaatagaggttattgtt
gtcttgggaaaagaagaccttaccattaagatttcagacagaggaggtggtgttcccctg
agaattattgaccgcctctttagttatacatactccactgcaccaacgcctgtgatggat
aattcccggaatgctcctttggctggttttggttacggcttgccaatttctcgtctgtat
gccaagtactttcaaggagatctgaatctctactctttatcaggatatggaacagatgct
atcatctacttaaaggctttgtcttctgagtctatagaaaaacttccagtttttaacaag
tcagccttcaaacattatcagatgagctctgaggcggatgactggtgtatcccaagcagg
gaaccaaagaacctggcaaaagaagtggccatgtga

DBGET integrated database retrieval system