KEGG   Pan troglodytes (chimpanzee): 472456Help
Entry
472456            CDS       T01005                                 

Gene name
CYP3A43
Definition
cytochrome P450 subfamily IIIA polypeptide 43
Orthology
K17692  
cytochrome P450, family 3, subfamily A, polypeptide 43 [EC:1.14.14.1]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Chemical carcinogenesis
Class
Human Diseases; Cancers; Chemical carcinogenesis [PATH:ptr05204]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
7
AA seq 420 aa AA seqDB search
MDLIPNFAMETWVLVATSLVLLYIYGTHSHKLFKKLGIPGPTPLPFLGTILFYLRGLWNF
DRECNEKYGEMWELYEGQQPMLVIMDPDMIKTVLVKECYSVFTNRLPLGPMGFLKSALSF
AEDEEWKRIRTLLSPAFTSVKFKEMVPIISQCGDMLVRSLRQEAENSKSINLKDFFGAYT
MDVITGTLFGVNLDSLNNPQDPFLKNMKKLLKLDFLDPFLLLISLFPFLTPVFEALNIGL
FPKDVTHFLKNSIERMKESRLKDKQKHRVDFFQQMIDSQNSKETKSHKALSDLELVAQSI
IIIFAAYDTTSTTLPFIMYELATHPDVQQKLQEEIDAVLPNKAPVTYDALVQMEYLDMVV
NETLRLFPVVSRVTRVCKKDIEINGVFIPKGLAVMVPIYALHHDPKYWTEPEKFCPERSH
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atggatctcattccaaactttgccatggaaacatgggttctcgtggctaccagtctggta
ctcctctatatttatgggacccattcacataaactttttaagaagctgggaattcctggg
ccaacccctctgccttttctgggaactattttgttctaccttaggggtctttggaatttt
gacagagaatgtaatgaaaaatacggagaaatgtgggagctgtatgaggggcaacagccc
atgctggtcatcatggatcccgacatgatcaaaacagtgctagtgaaagaatgttactct
gtcttcacaaaccggctgcctttaggtccaatgggatttctgaaaagtgccttaagtttt
gctgaagatgaagaatggaagagaatacgaacactgctatctccagctttcaccagtgtg
aaattcaaggaaatggtccccataatttcccaatgtggagatatgttggtgagaagcctg
aggcaggaagcagagaacagcaagtccatcaacttgaaagatttctttggggcctacacc
atggatgtaatcactggcacattatttggagtgaacttggattctctcaacaacccacaa
gatccctttctgaaaaatatgaagaagcttttaaaattggattttttggatcccttttta
ctcttaatatcactctttccatttcttaccccagtttttgaagccctaaatatcggtttg
tttccaaaagatgttacccattttttaaaaaattccattgaaaggatgaaagaaagtcgc
ctcaaagataagcaaaagcatcgagtagatttctttcaacagatgatcgactcccagaat
tccaaagaaacaaagtcccataaagctctgtctgatctggagcttgtggcccagtcaatt
atcatcatttttgctgcctatgacacaactagcaccactctccccttcattatgtatgaa
ctggccactcaccctgatgtccagcagaaactgcaggaggagattgacgcagttttaccc
aataaggcacctgtcacctacgatgccctggtacagatggagtaccttgacatggtggtg
aatgaaacgctcagattattcccagttgttagtagagttacgagagtctgcaagaaagat
attgaaatcaatggagtgttcattcccaaagggttagcagtgatggttccaatctatgct
cttcaccatgacccaaagtactggacagagcctgagaagttctgccctgaaagatcccac
tga

DBGET integrated database retrieval system