KEGG   Pan troglodytes (chimpanzee): 472456Help
Entry
472456            CDS       T01005                                 

Gene name
CYP3A43
Definition
cytochrome P450 subfamily IIIA polypeptide 43
Orthology
K17692  
cytochrome P450, family 3, subfamily A, polypeptide 43 [EC:1.14.14.1]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    472456 (CYP3A43)
Enzymes [BR:ptr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     472456 (CYP3A43)
Cytochrome P450 [BR:ptr00199]
 Cytochrome P450, animal type
  CYP3 family
   472456 (CYP3A43)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
7
AA seq 420 aa AA seqDB search
MDLIPNFAMETWVLVATSLVLLYIYGTHSHKLFKKLGIPGPTPLPFLGTILFYLRGLWNF
DRECNEKYGEMWELYEGQQPMLVIMDPDMIKTVLVKECYSVFTNRLPLGPMGFLKSALSF
AEDEEWKRIRTLLSPAFTSVKFKEMVPIISQCGDMLVRSLRQEAENSKSINLKDFFGAYT
MDVITGTLFGVNLDSLNNPQDPFLKNMKKLLKLDFLDPFLLLISLFPFLTPVFEALNIGL
FPKDVTHFLKNSIERMKESRLKDKQKHRVDFFQQMIDSQNSKETKSHKALSDLELVAQSI
IIIFAAYDTTSTTLPFIMYELATHPDVQQKLQEEIDAVLPNKAPVTYDALVQMEYLDMVV
NETLRLFPVVSRVTRVCKKDIEINGVFIPKGLAVMVPIYALHHDPKYWTEPEKFCPERSH
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atggatctcattccaaactttgccatggaaacatgggttctcgtggctaccagtctggta
ctcctctatatttatgggacccattcacataaactttttaagaagctgggaattcctggg
ccaacccctctgccttttctgggaactattttgttctaccttaggggtctttggaatttt
gacagagaatgtaatgaaaaatacggagaaatgtgggagctgtatgaggggcaacagccc
atgctggtcatcatggatcccgacatgatcaaaacagtgctagtgaaagaatgttactct
gtcttcacaaaccggctgcctttaggtccaatgggatttctgaaaagtgccttaagtttt
gctgaagatgaagaatggaagagaatacgaacactgctatctccagctttcaccagtgtg
aaattcaaggaaatggtccccataatttcccaatgtggagatatgttggtgagaagcctg
aggcaggaagcagagaacagcaagtccatcaacttgaaagatttctttggggcctacacc
atggatgtaatcactggcacattatttggagtgaacttggattctctcaacaacccacaa
gatccctttctgaaaaatatgaagaagcttttaaaattggattttttggatcccttttta
ctcttaatatcactctttccatttcttaccccagtttttgaagccctaaatatcggtttg
tttccaaaagatgttacccattttttaaaaaattccattgaaaggatgaaagaaagtcgc
ctcaaagataagcaaaagcatcgagtagatttctttcaacagatgatcgactcccagaat
tccaaagaaacaaagtcccataaagctctgtctgatctggagcttgtggcccagtcaatt
atcatcatttttgctgcctatgacacaactagcaccactctccccttcattatgtatgaa
ctggccactcaccctgatgtccagcagaaactgcaggaggagattgacgcagttttaccc
aataaggcacctgtcacctacgatgccctggtacagatggagtaccttgacatggtggtg
aatgaaacgctcagattattcccagttgttagtagagttacgagagtctgcaagaaagat
attgaaatcaatggagtgttcattcccaaagggttagcagtgatggttccaatctatgct
cttcaccatgacccaaagtactggacagagcctgagaagttctgccctgaaagatcccac
tga

DBGET integrated database retrieval system