KEGG   Pan troglodytes (chimpanzee): 472470Help
Entry
472470            CDS       T01005                                 

Gene name
MYL10
Definition
myosin, light chain 10, regulatory
Orthology
K12756  
myosin regulatory light chain 10
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Focal adhesion
Tight junction
Leukocyte transendothelial migration
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    472470 (MYL10)
  Cellular commiunity
   04510 Focal adhesion
    472470 (MYL10)
   04530 Tight junction
    472470 (MYL10)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    472470 (MYL10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
7
AA seq 226 aa AA seqDB search
MLLRLVSNSWPQVILPPRPPKVLGLQAPRRARKRAEGTASSNVFSMFDQSQIQEFKESLA
LSPRLERNGMISAHCNLCLTGSSNSPASASQAFTIMDQNRDGFIDKEDLRDTFAALGRIN
VKNEELEAMVKEAPGPINFTVFLTMFGEKLKGTDPEETILHAFKVFDTEGKGFVKADVIK
EKLMTQADRFSEEEVKQMFAAFPPDVCGNLDYRNLCYVITHGEEKD
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgttgcttaggctggtctcaaactcctggcctcaagtgatactccctcctcggcctccc
aaagtgctgggattacaggcaccgagaagagctcggaaaagagcagaaggcaccgccagc
tccaacgtcttctccatgtttgatcagtcccagatccaggagtttaaagagagtctggct
ctgtcgcccaggctggagcgcaatggcatgatctcggctcactgcaacctctgcctcacg
ggttcaagcaattctcctgcctcagcctcccaagctttcaccatcatggaccagaaccgc
gatggcttcattgacaaagaggacttgagggacacctttgccgcgctgggccgcatcaat
gtcaagaacgaggaactggaggccatggtgaaggaggcccccggacccatcaacttcacg
gtgttcctgaccatgtttggggagaagctgaagggcacggacccagaggagaccattctc
cacgccttcaaagtgttcgacactgaagggaaaggtttcgtcaaggccgatgtcatcaaa
gaaaaacttatgacccaggcagatcgcttcagtgaggaggaggtcaagcagatgtttgca
gcgtttcccccagatgtgtgcggcaacctggactacagaaacctgtgctacgtcatcact
cacggtgaagagaaggattag

DBGET integrated database retrieval system