KEGG   Pan troglodytes (chimpanzee): 472524Help
Entry
472524            CDS       T01005                                 

Gene name
NUP205
Definition
(RefSeq) nucleoporin 205
  KO
K14310  
nuclear pore complex protein Nup205
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    472524 (NUP205)
Messenger RNA biogenesis [BR:ptr03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     472524 (NUP205)
Chromosome [BR:ptr03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    472524 (NUP205)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
7
AA seq 2004 aa AA seqDB search
MTASLWGPYKDIWHKVGNALWRRQPEAVHLLDKILKKHKPDFISLFKNPPKNVQQHEKVQ
KASTEGVAIQGQQGTRLLPEQLIKEAFILSDLFDIGELAAVELLLAGEHQQPHFPGLTRG
LVAVLLYWDGKRCIANSLKALIQSRRGKTWTLELSPELASMTTRFTDELMEQGLTYKVLT
LVSQIDVNNEFEKLQRERGLGSEKHRKEVSDLIKECRQSLAESLFAWACQSPLGKEDTLL
LIGHLERVTVEANGSLDAVNLALLMALLYCFDISFIEQSTEERDDMIHQLPLLTEKQYIA
TIHSRLQDSQLWKLPGLQATVRLAWALALRGISQLPDVTALAEFTEADEAMAELAIADNV
FLFLTESVVVSEYFYQEEFYIRRVHNLITDFLALMPMKVKQLRNRADEDARMIHMSMQMG
NEPPISLRRDLEHLMLLIGELYKKNPFHLELALEYWCPTEPLQTPTIMGSYLGVAHQRPP
QRQVVLSKFVRQMGDLLPPTIYIPYLKMLQGLANGPQCAHYCFSLLKVNGSSHVENIQGA
GGSPVSWEHFFHSLMLYHEHLRKDLPSADSVQYRHLPSRGITQKEQDGLIAFLQLTSTII
TWSENARLALCEHPQWTPVVVTLGLLQCSIPPVLKAELLKTLAAFGKSPEIAASLWQSLE
YTQILQTVRIPSQRQAIGIEVELNEIESRCEEYPLTRAFCQLISTLVESSFPSNLGAGLR
PPGFDPYLQFLRDSVFLRFRTRAYRRAAEKWEVAEVVLEVFYKLLRDYEPQLEDFIDQFV
ELQGEEIIAYKPPGFSLMYHLLNESPMLELALSLLEEGVKQLDTYAPFPGKKHLEKAVQH
CLALLNLTLQKENLFMDLLRESQLALIVCPLEQLLQGINPRTKKADNVVNIARYLYHGNT
NPELAFESAKILCCISCNSNIQIKLVGDFTHDQSISQKLMAGFVECLDCEDAEEFVRLEE
GSELEKKLVAIRHETRIHILNLLITSLECNPPNLALYLLGFELKKPVSTTNLQDPGVLGC
PRTCLHAILNILEKGTEGRTGPVAVRESPQLAELCYQVIYQLCACSDTSGPTMRYLRTSQ
DFLFSQLQYLPFSNKEYEISMLNQMSWLMKTASIELRVTSLNRQRSHTQRLLHLLLDDMP
VKPYSDGEGGIEDENRSVSGFLHFDTATKVRRKILNILDSIDFSQEIPEPLQLDFFDRAQ
IEQVIANCEHKNLRGQTVCNVKLLHRVLVAEVNALQGMAAIGQRPLLMEEISTVLQYVVG
RNKLLQCLHAKRHALESWRQLVEIILTACPQDLIQAEDRQLIIRDILQDVHDKILDDEAA
QELMPVVAGAVFTLTAHLSQAVLTEQKQTSVLGPAEAHYAFMLDSCFTSPPPEENPLVGF
ASIGDSSLYIILKKLLNFILKTGGGFQRVRTHLYGSLLYYLQIAQRPDEPDTLEAAKKTM
WERLTAPEDVFSKLQRENIAIIESYGAALMEVVCRDACDGHEIGRMLALALLDRIVSVDK
QQQWLLYLSNSGYLKVLVDSLVEDDRTLQSLLTPQPPLLKALYTYESKMAFLTRVAKIQQ
GALELLRSGVIVRLAQCQVYDMRPETDPQSMFGMRDPPMFIPTPVDRYRQILLPALQLCQ
VILTSSMAQHLQAAGQVLQFLISHSDTIQAVLRCQDVSAGSLQELALLTGIISKAALPGI
LSELDVDVNEGSLMELQGHIGRFQRQCLGLLSRFGGSDRLRQFKFQDDNVEGDKVSKKDE
IELAMQQICANVMEYCQSLMLQSSSTFQHAVCLFTPSLSETVNRDGPRQDTQAPVVPYWR
LPGLGIIIYLLKQSANDFFSYYDSHRQSVSKLQNVEQLPPDEIKELCQSVMPAGVDKIST
AQKYVLARRRLVKVINNRAKLLSLCSFIIETCLFILWRHLEYYLLHCMATDSQDSLFASR
TLFKSRRLQDSFASETNLDFRSGLAIVSQHDLDQLQADAINAFGESLQKKLLDIEGLYSK
VRSRYSFIQALVRRIRGLLRISRN
NT seq 6015 nt NT seq  +upstreamnt  +downstreamnt
atgactgctagtctatggggtccttacaaagacatttggcataaagtgggaaatgctctt
tggagaagacaacctgaagctgttcaccttcttgataagatattgaagaaacacaaacct
gacttcatctcattgttcaaaaatccgccaaaaaatgttcaacagcatgagaaggttcag
aaagccagtacagagggagtcgccattcagggtcaacagggaactcgacttcttcctgaa
cagctcattaaagaagcctttattctcagtgacctttttgatattggagaattggcagct
gttgagcttcttcttgctggagagcatcaacagccacattttcctggccttaccagagga
ttagtagctgttcttttgtactgggatggaaagcgatgcattgcgaattccttgaaagcc
ttgatacagtctagacggggaaagacatggaccctagaactcagtcctgagctggcttcc
atgacaacacgctttacagatgagctgatggagcaaggattgacttataaagttcttacc
ctggtgtcacagattgatgtgaataatgagtttgagaaactacagcgagagagaggtttg
ggcagtgaaaaacatcgcaaagaggtttctgatctcattaaggagtgcaggcagtctctt
gcagaaagcctttttgcctgggcttgccagtcacctttaggcaaagaagacactctcctc
ctcattggacatttggaaagagtgacagttgaggctaatggctcactggatgcagtgaat
ctggctcttcttatggcgcttctgtactgttttgatatcagttttatagagcaaagcaca
gaggaacgagatgatatgattcatcaacttccactgttgacagaaaaacagtacattgca
acaattcactctcgtcttcaggactcacagctttggaaactgcctgggctccaagccact
gttagacttgcctgggcgctggcattgaggggaatatcccagctacccgatgtgacagct
ctggcagaattcacagaggcagatgaagcaatggcagaactcgcaattgctgacaacgtt
ttcctgttcctcacggaatctgtagtggtatcagaatacttttatcaggaagaattttat
attcgcagagtccataatctcatcacagattttcttgcacttatgccaatgaaggtgaaa
cagctgaggaatcgggcagatgaagatgctcgaatgattcacatgagtatgcagatgggt
aatgaaccccccatttcacttagaagggacctggaacacttaatgcttttgattggcgag
ctatataaaaagaacccttttcatctggagcttgctctagaatattggtgtcccacagag
cctcttcagactccaactatcatgggctcttatctaggggtggctcatcagcggccccct
caacgccaggttgtcttgtcaaagtttgttaggcaaatgggtgacctgttgcctccaact
atttatattccttatttgaagatgctccagggattggccaatgggcctcagtgtgcccac
tactgtttcagcctgctcaaagtcaatggtagtagtcatgttgaaaatattcagggagca
ggtggcagtcctgtttcctgggaacatttctttcactccttgatgctttaccacgaacac
cttcggaaggatcttccaagtgcagatagcgtccagtaccgtcaccttccttcccgtggc
atcacccagaaggagcaagatggattgattgcttttttgcagctcacgtctaccatcatt
acttggagtgaaaatgctcgcttggcactctgtgaacaccctcagtggacccctgttgtg
gtgactctgggactcctccaatgcagtattccccctgtcctaaaagctgagctactgaag
acactcgcagcttttggaaaatctcctgaaattgctgcttccctctggcagtcattggaa
tacactcagatactgcagaccgtgaggattccaagtcaaaggcaagctattggtattgag
gttgaactaaatgaaatagaatcccggtgtgaagaatacccattgactcgggccttttgc
cagcttattagtaccctggtggagagctcatttccttctaatttgggtgctggactgcgg
ccccctggctttgacccttatttgcagttccttagagactctgtgtttctacgattccgt
acgagagcttaccggagagcagctgaaaagtgggaagttgctgaggtggttttggaggtg
ttttataaattgctcagagattacgagcctcagcttgaagattttatagaccagtttgtg
gaactacaaggagaagaaatcatagcctataagccacctggatttagtctgatgtatcat
ctgctgaatgagtcaccaatgttggagcttgctctcagtttactggaagaaggagttaag
cagcttgacacctatgccccctttcctgggaaaaaacacctggagaaagcagtacagcat
tgccttgcacttctcaatcttactctgcagaaggaaaatctttttatggaccttctaaga
gagagtcaactggctctaatagtctgtcctttagaacagcttttgcagggaattaatccc
agaactaagaaggcagataatgtggtaaacattgccagatacctatatcatggcaatact
aatccagaattggcttttgaaagcgccaagatcctctgttgtatctcttgcaactctaat
attcagataaagttggttggagatttcacacatgaccagagtataagtcagaaactaatg
gctggatttgtggagtgtttggattgtgaagatgcagaagaatttgtacgtctggaagag
ggatcagaacttgaaaagaaattagttgcaattcgtcatgaaacaagaatccacatcttg
aatcttctcattacctctctggaatgcaatccacccaatcttgctctctacctgttgggc
tttgaattgaaaaaacctgtcagtactacaaacctacaagatccaggagtgttaggttgc
cctcggacatgccttcacgccattctaaacatcttggagaaaggaacggaagggagaaca
ggcccagtggcagtgcgagaatctcctcaactggctgagctatgttaccaggtcatatat
cagttatgtgcatgctctgatacatctggtcctactatgaggtacttgagaaccagccag
gatttcttattttcccagttgcagtatctaccattttctaacaaagaatatgaaatatct
atgctgaaccagatgtcatggcttatgaaaactgcctcaatagagctaagggtaacctct
ctgaatcgtcagcggtcgcatacccagaggctcctacacctcttactggatgacatgcca
gtgaaaccatactcagatggtgaaggaggaatagaagatgaaaacaggtctgtttctggg
ttccttcactttgacactgctacaaaagtacgtcgaaaaattctaaatattcttgactcg
attgacttcagtcaggagatccctgagcctttgcagttggatttttttgatcgggcccag
attgaacaagttattgctaactgtgaacacaagaatttacggggacagacagtctgcaat
gtcaagcttcttcatagggttcttgtagctgaagtaaatgcccttcagggtatggcagcc
ataggacagagacctctactaatggaggaaatcagcactgtacttcagtatgtggtagga
agaaataaattgctgcagtgtcttcatgcaaaacgtcatgctctggagtcgtggaggcaa
ctggtagaaattatactgacagcttgtccccaggacctcattcaggcagaggatcgacaa
ctgattattcgtgatattttacaagatgtgcatgataagatactggatgatgaagctgcg
caagagttaatgcctgtggtcgccggggcagtgttcacactgactgctcacctaagccag
gccgtcctcactgaacagaagcaaacatcagtcttgggaccagcagaggcccattacgct
tttatgcttgatagttgcttcacctcacctcctcctgaagagaacccattagtgggtttt
gcttctattggagattcttcactttacatcatattgaagaaactgttaaacttcattttg
aagacaggtggtggattccaacgagtgaggactcacttgtatggctctctgctttattac
ttacagattgcccagagacctgatgaaccagacaccttagaagcagccaagaaaaccatg
tgggaaaggctgacagcccctgaagatgtatttagcaaattacagcgagaaaacatagcc
attattgaaagttatggcgccgccctcatggaagtggtctgtcgagatgcttgtgatggt
catgagattggaaggatgctggccctggctctacttgatagaattgtctccgtggataaa
cagcagcagtggcttttgtatctttctaacagtggctacttgaaggtcctcgtagacagc
ttggtagaagatgaccgtactttgcagagcttactcaccccacagcctccccttttaaaa
gcactttatacttatgaatctaaaatggcatttctcacaagagtggcaaagatacagcag
ggtgcattagagctgctaagatcaggggtgattgtgagactagctcaatgccaagtctat
gacatgcgcccagaaacggacccgcagagcatgtttggcatgagagaccctccaatgttc
atccctaccccagtggatcgctaccgccagattctcctcccagctctccagctgtgccag
gtcatcctcacatctagtatggcccagcacttgcaggcagcagggcaggtattgcagttt
cttatttcacattctgataccatacaagcagttctgcgctgtcaggatgttagtgctggg
tctttgcaggaattggctctgctgacaggaattataagtaaagcagcacttcctgggata
ttaagtgaacttgacgttgatgtaaatgaagggtctctaatggagctacagggacatatt
ggaagattccagcgccagtgcttaggactactaagtcgctttggtggctctgacagactg
cgtcagtttaaatttcaagacgataatgtggagggagataaagtaagcaagaaagatgag
attgaactggctatgcagcagatttgtgccaatgtaatggaatattgccagtcactcatg
ttacagagttcctctaccttccagcatgctgtgtgtctcttcactcctagcctttcagaa
acagttaatagagatggaccgcggcaagatacccaagctccagtggttccatactggcgc
ctgcctggtttaggcattatcatctacctgctgaaacagagtgctaatgatttcttcagc
tattatgacagtcatcgacagagtgtcagcaagctacaaaatgtagagcagcttccccca
gatgagataaaagagttgtgtcagtctgtgatgcctgctggtgttgataaaatctccact
gcccagaaatatgttctagcaagacggcgcttggtgaaggtgatcaacaatcgagctaaa
ctgctttccctttgttcttttatcatagagacctgcctatttattctttggcgccatctg
gagtactacttgttacattgcatggccacggattctcaagattccttatttgcctcgaga
accttgtttaaaagcagaagactgcaagattccttcgcctcagaaaccaatctagatttt
agaagtgggctggctatagtgagccaacatgatttagaccagcttcaggctgatgcaatc
aacgcttttggagaatcactacaaaagaaacttctggacattgaaggattatattcaaaa
gttcgatctcgatatagtttcatacaggctcttgtcagacgtatccgtggcctcttgagg
atatcaaggaactga

DBGET integrated database retrieval system