KEGG   Pan troglodytes (chimpanzee): 472524Help
Entry
472524            CDS       T01005                                 

Gene name
NUP205
Definition
nucleoporin 205kDa
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
RNA transport
Module
Nuclear pore complex
Class
Genetic Information Processing; Translation; RNA transport [PATH:ptr03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
7
AA seq 2012 aa AA seqDB search
MATPLAVNSAASLWGPYKDIWHKVGNALWRRQPEAVHLLDKILKKHKPDFISLFKNPPKN
VQQHEKVQKASTEGVAIQGQQGTRLLPEQLIKEAFILSDLFDIGELAAVELLLAGEHQQP
HFPGLTRGLVAVLLYWDGKRCIANSLKALIQSRRGKTWTLELSPELASMTTRFTDELMEQ
GLTYKVLTLVSQIDVNNEFEKLQRERGLGSEKHRKEVSDLIKECRQSLAESLFAWACQSP
LGKEDTLLLIGHLERVTVEANGSLDAVNLALLMALLYCFDISFIEQSTEERDDMIHQLPL
LTEKQYIATIHSRLQDSQLWKLPGLQATVRLAWALALRGISQLPDVTALAEFTEADEAMA
ELAIADNVFLFLTESVVVSEYFYQEEFYIRRVHNLITDFLALMPMKVKQLRNRADEDARM
IHMSMQMGNEPPISLRRDLEHLMLLIGELYKKNPFHLELALEYWCPTEPLQTPTIMGSYL
GVAHQRPPQRQVVLSKFVRQMGDLLPPTIYIPYLKMLQGLANGPQCAHYCFSLLKVNGSS
HVENIQGAGGSPVSWEHFFHSLMLYHEHLRKDLPSADSVQYRHLPSRGITQKEQDGLIAF
LQLTSTIITWSENARLALCEHPQWTPVVVTLGLLQCSIPPVLKAELLKTLAAFGKSPEIA
ASLWQSLEYTQILQTVRIPSQRQAIGIEVELNEIESRCEEYPLTRAFCQLISTLVESSFP
SNLGAGLRPPGFDPYLQFLRDSVFLRFRTRAYRRAAEKWEVAEVVLEVFYKLLRDYEPQL
EDFIDQFVELQGEEIIAYKPPGFSLMYHLLNESPMLELALSLLEEGVKQLDTYAPFPGKK
HLEKAVQHCLALLNLTLQKENLFMDLLRESQLALIVCPLEQLLQGINPRTKKADNVVNIA
RYLYHGNTNPELAFESAKILCCISCNSNIQIKLVGDFTHDQSISQKLMAGFVECLDCEDA
EEFVRLEEGSELEKKLVAIRHETRIHILNLLITSLECNPPNLALYLLGFELKKPVSTTNL
QDPGVLGCPRTCLHAILNILEKGTEGRTGPVAVRESPQLAELCYQVIYQLCACSDTSGPT
MRYLRTSQDFLFSQLQYLPFSNKEYEISMLNQMSWLMKTASIELRVTSLNRQRSHTQRLL
HLLLDDMPVKPYSDGEGGIEDENRSVSGFLHFDTATKVRRKILNILDSIDFSQEIPEPLQ
LDFFDRAQIEQVIANCEHKNLRGQTVCNVKLLHRVLVAEVNALQGMAAIGQRPLLMEEIS
TVLQYVVGRNKLLQCLHAKRHALESWRQLVEIILTACPQDLIQAEDRQLIIRDILQDVHD
KILDDEAAQELMPVVAGAVFTLTAHLSQAVLTEQKQTSVLGPAEAHYAFMLDSCFTSPPP
EENPLVGFASIGDSSLYIILKKLLNFILKTGGGFQRVRTHLYGSLLYYLQIAQRPDEPDT
LEAAKKTMWERLTAPEDVFSKLQRENIAIIESYGAALMEVVCRDACDGHEIGRMLALALL
DRIVSVDKQQQWLLYLSNSGYLKVLVDSLVEDDRTLQSLLTPQPPLLKALYTYESKMAFL
TRVAKIQQGALELLRSGVIVRLAQCQVYDMRPETDPQSMFGMRDPPMFIPTPVDRYRQIL
LPALQLCQVILTSSMAQHLQAAGQVLQFLISHSDTIQAILRCQDVSAGSLQELALLTGII
SKAALPGILSELDVDVNEGSLMELQGHIGRFQRQCLGLLSRFGGSDRLRQFKFQDDNVEG
DKVSKKDEIELAMQQICANVMEYCQSLMLQSSSTFQHAVCLFTPSLSETVNRDGPRQDTQ
APVVPYWRLPGLGIIIYLLKQSANDFFSYYDSHRQSVSKLQNVEQLPPDEIKELCQSVMP
AGVDKISTAQKYVLARRRLVKVINNRAKLLSLCSFIIETCLFILWRHLEYYLLHCMATDS
QDSLFASRTLFKSRRLQDSFASETNLDFRSGLAIVSQHDLDQLQADAINAFGESLQKKLL
DIEGLYSKVRSRYSFIQALVRRIRGLLRISRN
NT seq 6039 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgcctttggcggtaaattcggctgctagtctatggggtccttacaaagacatt
tggcataaagtgggaaatgctctttggagaagacaacctgaagctgttcaccttcttgat
aagatattgaagaaacacaaacctgacttcatctcattgttcaaaaatccgccaaaaaat
gttcaacagcatgagaaggttcagaaagccagtacagagggagtcgccattcagggtcaa
cagggaactcgacttcttcctgaacagctcattaaagaagcctttattctcagtgacctt
tttgatattggagaattggcagctgttgagcttcttcttgctggagagcatcaacagcca
cattttcctggccttaccagaggattagtagctgttcttttgtactgggatggaaagcga
tgcattgcgaattccttgaaagccttgatacagtctagacggggaaagacatggacccta
gaactcagtcctgagctggcttccatgacaacacgctttacagatgagctgatggagcaa
ggattgacttataaagttcttaccctggtgtcacagattgatgtgaataatgagtttgag
aaactacagcgagagagaggtttgggcagtgaaaaacatcgcaaagaggtttctgatctc
attaaggagtgcaggcagtctcttgcagaaagcctttttgcctgggcttgccagtcacct
ttaggcaaagaagacactctcctcctcattggacatttggaaagagtgacagttgaggct
aatggctcactggatgcagtgaatctggctcttcttatggcgcttctgtactgttttgat
atcagttttatagagcaaagcacagaggaacgagatgatatgattcatcaacttccactg
ttgacagaaaaacagtacattgcaacaattcactctcgtcttcaggactcacagctttgg
aaactgcctgggctccaagccactgttagacttgcctgggcgctggcattgaggggaata
tcccagctacccgatgtgacagctctggcagaattcacagaggcagatgaagcaatggca
gaactcgcaattgctgacaacgttttcctgttcctcacggaatctgtagtggtatcagaa
tacttttatcaggaagaattttatattcgcagagtccataatctcatcacagattttctt
gcacttatgccaatgaaggtgaaacagctgaggaatcgggcagatgaagatgctcgaatg
attcacatgagtatgcagatgggtaatgaaccccccatttcacttagaagggacctggaa
cacttaatgcttttgattggcgagctatataaaaagaacccttttcatctggagcttgct
ctagaatattggtgtcccacagagcctcttcagactccaactatcatgggctcttatcta
ggggtggctcatcagcggccccctcaacgccaggttgtcttgtcaaagtttgttaggcaa
atgggtgacctgttgcctccaactatttatattccttatttgaagatgctccagggattg
gccaatgggcctcagtgtgcccactactgtttcagcctgctcaaagtcaatggtagtagt
catgttgaaaatattcagggagcaggtggcagtcctgtttcctgggaacatttctttcac
tccttgatgctttaccacgaacaccttcggaaggatcttccaagtgcagatagcgtccag
taccgtcaccttccttcccgtggcatcacccagaaggagcaagatggattgattgctttt
ttgcagctcacgtctaccatcattacttggagtgaaaatgctcgcttggcactctgtgaa
caccctcagtggacccctgttgtggtgactctgggactcctccaatgcagtattccccct
gtcctaaaagctgagctactgaagacactcgcagcttttggaaaatctcctgaaattgct
gcttccctctggcagtcattggaatacactcagatactgcagaccgtgaggattccaagt
caaaggcaagctattggtattgaggttgaactaaatgaaatagaatcccggtgtgaagaa
tacccattgactcgggccttttgccagcttattagtaccctggtggagagctcatttcct
tctaatttgggtgctggactgcggccccctggctttgacccttatttgcagttccttaga
gactctgtgtttctacgattccgtacgagagcttaccggagagcagctgaaaagtgggaa
gttgctgaggtggttttggaggtgttttataaattgctcagagattacgagcctcagctt
gaagattttatagaccagtttgtggaactacaaggagaagaaatcatagcctataagcca
cctggatttagtctgatgtatcatctgctgaatgagtcaccaatgttggagcttgctctc
agtttactggaagaaggagttaagcagcttgacacctatgccccctttcctgggaaaaaa
cacctggagaaagcagtacagcattgccttgcacttctcaatcttactctgcagaaggaa
aatctttttatggaccttctaagagagagtcaactggctctaatagtctgtcctttagaa
cagcttttgcagggaattaatcccagaactaagaaggcagataatgtggtaaacattgcc
agatacctatatcatggcaatactaatccagaattggcttttgaaagcgccaagatcctc
tgttgtatctcttgcaactctaatattcagataaagttggttggagatttcacacatgac
cagagtataagtcagaaactaatggctggatttgtggagtgtttggattgtgaagatgca
gaagaatttgtacgtctggaagagggatcagaacttgaaaagaaattagttgcaattcgt
catgaaacaagaatccacatcttgaatcttctcattacctctctggaatgcaatccaccc
aatcttgctctctacctgttgggctttgaattgaaaaaacctgtcagtactacaaaccta
caagatccaggagtgttaggttgccctcggacatgccttcacgccattctaaacatcttg
gagaaaggaacggaagggagaacaggcccagtggcagtgcgagaatctcctcaactggct
gagctatgttaccaggtcatatatcagttatgtgcatgctctgatacatctggtcctact
atgaggtacttgagaaccagccaggatttcttattttcccagttgcagtatctaccattt
tctaacaaagaatatgaaatatctatgctgaaccagatgtcatggcttatgaaaactgcc
tcaatagagctaagggtaacctctctgaatcgtcagcggtcgcatacccagaggctccta
cacctcttactggatgacatgccagtgaaaccatactcagatggtgaaggaggaatagaa
gatgaaaacaggtctgtttctgggttccttcactttgacactgctacaaaagtacgtcga
aaaattctaaatattcttgactcgattgacttcagtcaggagatccctgagcctttgcag
ttggatttttttgatcgggcccagattgaacaagttattgctaactgtgaacacaagaat
ttacggggacagacagtctgcaatgtcaagcttcttcatagggttcttgtagctgaagta
aatgcccttcagggtatggcagccataggacagagacctctactaatggaggaaatcagc
actgtacttcagtatgtggtaggaagaaataaattgctgcagtgtcttcatgcaaaacgt
catgctctggagtcgtggaggcaactggtagaaattatactgacagcttgtccccaggac
ctcattcaggcagaggatcgacaactgattattcgtgatattttacaagatgtgcatgat
aagatactggatgatgaagctgcgcaagagttaatgcctgtggtcgccggggcagtgttc
acactgactgctcacctaagccaggccgtcctcactgaacagaagcaaacatcagtcttg
ggaccagcagaggcccattacgcttttatgcttgatagttgcttcacctcacctcctcct
gaagagaacccattagtgggttttgcttctattggagattcttcactttacatcatattg
aagaaactgttaaacttcattttgaagacaggtggtggattccaacgagtgaggactcac
ttgtatggctctctgctttattacttacagattgcccagagacctgatgaaccagacacc
ttagaagcagccaagaaaaccatgtgggaaaggctgacagcccctgaagatgtatttagc
aaattacagcgagaaaacatagccattattgaaagttatggcgccgccctcatggaagtg
gtctgtcgagatgcttgtgatggtcatgagattggaaggatgctggccctggctctactt
gatagaattgtctccgtggataaacagcagcagtggcttttgtatctttctaacagtggc
tacttgaaggtcctcgtagacagcttggtagaagatgaccgtactttgcagagcttactc
accccacagcctccccttttaaaagcactttatacttatgaatctaaaatggcatttctc
acaagagtggcaaagatacagcagggtgcattagagctgctaagatcaggggtgattgtg
agactagctcaatgccaagtctatgacatgcgcccagaaacggacccgcagagcatgttt
ggcatgagagaccctccaatgttcatccctaccccagtggatcgctaccgccagattctc
ctcccagctctccagctgtgccaggtcatcctcacatctagtatggcccagcacttgcag
gcagcagggcaggtattgcagtttcttatttcacattctgataccatacaagcaattctg
cgctgtcaggatgttagtgctgggtctttgcaggaattggctctgctgacaggaattata
agtaaagcagcacttcctgggatattaagtgaacttgacgttgatgtaaatgaagggtct
ctaatggagctacagggacatattggaagattccagcgccagtgcttaggactactaagt
cgctttggtggctctgacagactgcgtcagtttaaatttcaagacgataatgtggaggga
gataaagtaagcaagaaagatgagattgaactggctatgcagcagatttgtgccaatgta
atggaatattgccagtcactcatgttacagagttcctctaccttccagcatgctgtgtgt
ctcttcactcctagcctttcagaaacagttaatagagatggaccgcggcaagatacccaa
gctccagtggttccatactggcgcctgcctggtttaggcattatcatctacctgctgaaa
cagagtgctaatgatttcttcagctattatgacagtcatcgacagagtgtcagcaagcta
caaaatgtagagcagcttcccccagatgagataaaagagttgtgtcagtctgtgatgcct
gctggtgttgataaaatctccactgcccagaaatatgttctagcaagacggcgcttggtg
aaggtgatcaacaatcgagctaaactgctttccctttgttcttttatcatagagacctgc
ctatttattctttggcgccatctggagtactacttgttacattgcatggccacggattct
caagattccttatttgcctcgagaaccttgtttaaaagcagaagactgcaagattccttc
gcctcagaaaccaatctagattttagaagtgggctggctatagtgagccaacatgattta
gaccagcttcaggctgatgcaatcaacgcttttggagaatcactacaaaagaaacttctg
gacattgaaggattatattcaaaagttcgatctcgatatagtttcatacaggctcttgtc
agacgtatccgtggcctcttgaggatatcaaggaactga

DBGET integrated database retrieval system