KEGG   Pan troglodytes (chimpanzee): 472772Help
Entry
472772            CDS       T01005                                 

Gene name
MOS
Definition
v-mos Moloney murine sarcoma viral oncogene homolog
Orthology
K04367  
proto-oncogene serine/threonine-protein kinase mos [EC:2.7.11.1]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
MAPK signaling pathway
Oocyte meiosis
Regulation of actin cytoskeleton
Progesterone-mediated oocyte maturation
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:ptr04010]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:ptr04810]
Cellular Processes; Cell growth and death; Oocyte meiosis [PATH:ptr04114]
Organismal Systems; Endocrine system; Progesterone-mediated oocyte maturation [PATH:ptr04914]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
8
AA seq 346 aa AA seqDB search
MPSPLALRPYLRSEFSPSVDARPCSSPSELPAKLLLGATPPRAPRLPRRLAWCSIDWEQV
CLLQRLGAGGFGSVYKATYRGVPVAIKQVNKCTKNRLASRRSFWAELNVARLRHDNIVRV
VAASTRTPAGSNSLGTIIMEFGGNVTLHQVIYGAAGHPEGDAGEPHCRTGGQLSLGKCLK
YSLDVVNGLLFLHSQSIVHLDLKPANILISEQDVCKISDFGCSEKLEDLRCFQTPSYPLG
GTYTHRAPELLKGEGVTPKADIYSFAITLWQMTTKQAPYSGERQHILYAVVAYDLRPSLS
AAVFEDSLPGQRLGDVIQRCWRPSAAQRPSARLLLVDLTSLKAELG
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgccctcgcccctggccctacgcccctacctccggagcgagttttccccatcggtggac
gcgcggccctgcagcagtccctcagagctacctgcgaagctgcttctgggggccactcct
cctcgggccccgcggctgccgcgccggctggcctggtgctccattgactgggagcaggtg
tgcttgctgcagaggctgggagctggagggtttggctcggtgtacaaggcgacttaccgc
ggtgttcctgtggccataaagcaagtgaacaagtgcaccaagaaccgactagcatctcgg
cggagtttctgggctgagctcaacgtagcaaggctgcgccacgataacatcgtgcgcgtg
gtggctgccagcacgcgcacgcccgcggggtccaatagcctagggaccatcatcatggag
ttcggtggcaacgtcactttacaccaagtcatctatggcgccgccggccaccctgagggg
gacgcaggggagcctcactgccgcactggaggacagttaagtttgggaaagtgtctcaag
tactcactagatgttgtgaacggcctgctcttcctccactcgcaaagcattgtgcacttg
gacctgaagcccgcgaacatcttgatcagtgagcaggatgtctgtaaaattagtgacttc
ggttgctctgagaagttggaagatctgcggtgcttccagacaccctcttaccctctagga
ggcacatacacccaccgcgccccggagctcctgaaaggagagggcgtgacgcctaaagcc
gacatttattcctttgccatcactctctggcaaatgactaccaagcaggcgccgtattcg
ggggagcggcagcacatactgtacgcggtggtggcctacgacctgcgcccgtccctctcc
gctgccgtcttcgaggactcgctccccgggcagcgccttggggacgtcatccagcgctgc
tggagacccagcgcggcgcagaggccgagcgcgcggctgcttttggtggatctcacctct
ttgaaagctgaactcggctga

DBGET integrated database retrieval system