KEGG   Pan troglodytes (chimpanzee): 472821Help
Entry
472821            CDS       T01005                                 

Gene name
RAD54B
Definition
RAD54 homolog B (S. cerevisiae)
Orthology
K10877  
DNA repair and recombination protein RAD54B [EC:3.6.4.-]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    472821 (RAD54B)
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     472821 (RAD54B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
8
AA seq 910 aa AA seqDB search
MRRSAAPSQLQGNSFKKPKFIPPGRSNPGLNEEITKLNPDIKLFEGVAINNTFLPSQNDL
RICSLNLPSDESTREINYRDNCSGKYCFEAPTLATLDPPHTVHSAPKEVAVSKEQEEKSD
SLVKYFSVVWCKPSKKKHKKWEGDAVLIVKGKSFILKNLEGKDIGRGIGYKFKELEKIEE
GQTLMICGKEIEVMGVISPDDFSSGRCFQLGGGSTAISRSSQVARKCFSNPFKSVCKPSS
KENRQNDFQNCKPRHDPYTPNSLVMPRPDKNHQWVFNKNCFPLVDVVIDPYLVYHLRPHQ
KEGIIFLYECVMGMRMNGSCGAILADEMGLGKTLQCISLIWTLQCQGPYGGKPVIKKTLI
VTPGSLVNNWKKEFQKWLGSERIKIFTVDQDHKVEEFIKSIFYSVLIISYEMLLRSLDQI
KNIKFDLLICDEGHRLKNSAIKTTTALISLSCEKRIILTGTPIQNDLQEFFALIDFVNPG
ILGSLSSYRKIYEEPIILSREPSASEEEKELGERRAAELTCLTGLFILRRTQEIINKYLP
PKIENVVFCRPGALQIELYRKLLNSQVVRFCLQGLLENSPHLICIGALKKLCNHPCLLFN
SIKEKECSSTCDKNEEKSLYKGLLSVFPADYNPLLFTEKESGKLQVLSKLLAVIHELRPT
EKVVLVSNYTQTLNILQEVCKRHGYAYTRLDGQTPISQRQQIVDGFNSQHSSFFIFLLSS
KAGGVGLNLIGGSHLILYDIDWNPATDIQAMSRVWRDGQKYPVHIYRLLTTGTIEEKIYQ
RQISKQGLCGAVVDLTKTSEHIQFSVEELKNLFTLHESSDCVTHDLLDCECTGEEVHTGD
SLEKFIVSRDCQLGPHHQKSNSLKPLSMSQLKQWKHFSGDHLNLTDPFLERITENVSFIF
QNITTQATGT
NT seq 2733 nt NT seq  +upstreamnt  +downstreamnt
atgagacgatctgcagcaccaagtcagttgcaggggaattccttcaaaaaaccaaaattt
atacctccaggaagaagtaatccaggtctgaatgaagagattacaaaactgaatccagat
ataaaattatttgagggtgttgcaattaataacacctttctcccatcacaaaatgatctt
agaatatgcagtttaaatctgcctagtgacgaaagtactagagaaatcaattacagagat
aattgcagtggaaaatattgttttgaagcacctacactggcaacattagatccacctcat
acagttcattcggctcctaaagaagtagcagtgtccaaggaacaagaagagaaatctgat
agcctagttaaatatttcagtgttgtttggtgtaagccttcaaagaaaaaacataaaaag
tgggaaggtgatgctgttcttattgtaaaaggaaagtcatttatattaaagaatttggaa
ggcaaagacattggaagaggcattggttataaattcaaagagcttgaaaagattgaagag
ggccaaacactgatgatttgtggaaaagaaatagaagtcatgggtgtaatctctccagat
gacttcagcagtggcaggtgttttcagcttggaggaggaagtactgctatctcgcgttct
tctcaggttgccaggaaatgtttctctaaccctttcaaaagtgtttgtaaaccaagttca
aaggaaaatagacagaatgatttccaaaattgcaaaccacgccatgacccatatacgcca
aattcccttgttatgccacgaccagataagaatcaccagtgggtattcaataagaactgt
ttccctcttgtggatgtagtgattgatccttaccttgtatatcatcttcgaccacatcag
aaagaaggaatcatattcctttatgaatgtgtaatgggaatgagaatgaatggcagttgt
ggagctattcttgctgatgaaatgggtttagggaagacattgcaatgtatttcgctcatc
tggaccctgcagtgtcagggaccctatggaggcaagccagtaataaagaagacactaatt
gtcacacctggaagcttggtgaataattggaagaaagaatttcaaaaatggctaggaagt
gaaaggatcaagatatttactgttgatcaggaccacaaagttgaagaattcatcaagtct
atattttattctgttcttattatcagttatgaaatgttacttcgttccctggatcaaatt
aagaatataaaatttgatcttctaatctgtgacgaggggcatcgtttgaagaacagtgcc
attaagacaactacagccctcattagcctttcttgtgagaaaagaataattctaactggt
actccaattcagaatgatctgcaggaattttttgcattaattgattttgtaaatccagga
atattaggctctttgtcatcttataggaaaatatatgaagaacccatcattttatcgaga
gaaccttctgcttctgaggaagaaaaggagttaggagaaagaagagcagctgaacttact
tgcctcactggactctttatccttagaagaacccaagaaattataaataaatatctccca
cctaaaatagagaatgttgtcttttgccgaccaggagcactacagattgagctttatcga
aagctgttaaattctcaggttgtcaggttctgccttcaagggttgttggaaaatagtccc
catctaatatgtataggagctcttaaaaaactgtgcaatcacccctgccttttgttcaac
tctataaaggaaaaggaatgtagctcaacttgtgataaaaatgaagaaaagagtctatac
aaaggcttgctaagcgtgtttcctgctgactacaaccctctcctgtttactgaaaaggag
tcaggaaaactacaggtgttgtccaagctcttagcggttatccacgaacttcgacctact
gaaaaggtggtgttggtatccaactatacacaaaccttgaacattttacaagaagtatgt
aagcgtcatggatatgcttatacaagacttgatggacaaacaccaatctctcaaaggcag
cagattgttgatggctttaacagtcaacactcttctttttttatttttttgttaagttca
aaagctggtggtgtaggacttaacctcattggaggatctcacttaattctctatgacatt
gattggaatccagccactgatattcaggcaatgtctagagtatggagagatggtcagaaa
tatcctgtacatatttacagactcctaactacaggtacaatagaagaaaagatctatcaa
aggcagatcagtaagcaaggtctttgtggggcagttgtcgacctcaccaagacatctgaa
catattcagttttcagtagaagaacttaaaaatttgttcacattacatgaaagttcagat
tgtgttactcatgatctgcttgactgtgagtgcacaggagaagaagttcatacaggtgat
tcgttggaaaaattcattgtctctagagattgtcagcttggtccacatcaccagaaatct
aactccctgaaacctctttctatgtcccagctgaagcaatggaaacatttttctggagat
catttaaatcttacagatccttttcttgaaagaataacagaaaatgtgtcattcattttt
cagaatataaccactcaagctactggcacatag

DBGET integrated database retrieval system