KEGG   Pan troglodytes (chimpanzee): 472944Help
Entry
472944            CDS       T01005                                 

Gene name
PRKACG
Definition
protein kinase, cAMP-dependent, catalytic, gamma
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
MAPK signaling pathway
Ras signaling pathway
Calcium signaling pathway
cAMP signaling pathway
Chemokine signaling pathway
Oocyte meiosis
Apoptosis
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Wnt signaling pathway
Hedgehog signaling pathway
Gap junction
Platelet activation
Circadian entrainment
Long-term potentiation
Retrograde endocannabinoid signaling
Glutamatergic synapse
Cholinergic synapse
Serotonergic synapse
GABAergic synapse
Dopaminergic synapse
Olfactory transduction
Taste transduction
Inflammatory mediator regulation of TRP channels
Insulin signaling pathway
Insulin secretion
GnRH signaling pathway
Ovarian steroidogenesis
Progesterone-mediated oocyte maturation
Estrogen signaling pathway
Melanogenesis
Thyroid hormone synthesis
Thyroid hormone signaling pathway
Oxytocin signaling pathway
Glucagon signaling pathway
Endocrine and other factor-regulated calcium reabsorption
Vasopressin-regulated water reabsorption
Salivary secretion
Gastric acid secretion
Bile secretion
Parkinson's disease
Prion diseases
Cocaine addiction
Amphetamine addiction
Morphine addiction
Amoebiasis
HTLV-I infection
Epstein-Barr virus infection
Pathways in cancer
Viral carcinogenesis
Proteoglycans in cancer
Dilated cardiomyopathy
Module
cAMP signaling
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    472944 (PRKACG)
   04010 MAPK signaling pathway
    472944 (PRKACG)
   04310 Wnt signaling pathway
    472944 (PRKACG)
   04340 Hedgehog signaling pathway
    472944 (PRKACG)
   04020 Calcium signaling pathway
    472944 (PRKACG)
   04024 cAMP signaling pathway
    472944 (PRKACG)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    472944 (PRKACG)
   04210 Apoptosis
    472944 (PRKACG)
  Cellular commiunity
   04540 Gap junction
    472944 (PRKACG)
 Organismal Systems
  Immune system
   04611 Platelet activation
    472944 (PRKACG)
   04062 Chemokine signaling pathway
    472944 (PRKACG)
  Endocrine system
   04911 Insulin secretion
    472944 (PRKACG)
   04910 Insulin signaling pathway
    472944 (PRKACG)
   04922 Glucagon signaling pathway
    472944 (PRKACG)
   04912 GnRH signaling pathway
    472944 (PRKACG)
   04913 Ovarian Steroidogenesis
    472944 (PRKACG)
   04915 Estrogen signaling pathway
    472944 (PRKACG)
   04914 Progesterone-mediated oocyte maturation
    472944 (PRKACG)
   04921 Oxytocin signaling pathway
    472944 (PRKACG)
   04918 Thyroid hormone synthesis
    472944 (PRKACG)
   04919 Thyroid hormone signaling pathway
    472944 (PRKACG)
   04916 Melanogenesis
    472944 (PRKACG)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    472944 (PRKACG)
   04270 Vascular smooth muscle contraction
    472944 (PRKACG)
  Digestive system
   04970 Salivary secretion
    472944 (PRKACG)
   04971 Gastric acid secretion
    472944 (PRKACG)
   04976 Bile secretion
    472944 (PRKACG)
  Excretory system
   04962 Vasopressin-regulated water reabsorption
    472944 (PRKACG)
   04961 Endocrine and other factor-regulated calcium reabsorption
    472944 (PRKACG)
  Nervous system
   04724 Glutamatergic synapse
    472944 (PRKACG)
   04727 GABAergic synapse
    472944 (PRKACG)
   04725 Cholinergic synapse
    472944 (PRKACG)
   04728 Dopaminergic synapse
    472944 (PRKACG)
   04726 Serotonergic synapse
    472944 (PRKACG)
   04720 Long-term potentiation
    472944 (PRKACG)
   04723 Retrograde endocannabinoid signaling
    472944 (PRKACG)
  Sensory system
   04740 Olfactory transduction
    472944 (PRKACG)
   04742 Taste transduction
    472944 (PRKACG)
   04750 Inflammatory mediator regulation of TRP channels
    472944 (PRKACG)
  Environmental adaptation
   04713 Circadian entrainment
    472944 (PRKACG)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    472944 (PRKACG)
   05205 Proteoglycans in cancer
    472944 (PRKACG)
   05203 Viral carcinogenesis
    472944 (PRKACG)
  Neurodegenerative diseases
   05012 Parkinson's disease
    472944 (PRKACG)
   05020 Prion diseases
    472944 (PRKACG)
  Substance dependence
   05030 Cocaine addiction
    472944 (PRKACG)
   05031 Amphetamine addiction
    472944 (PRKACG)
   05032 Morphine addiction
    472944 (PRKACG)
  Cardiovascular diseases
   05414 Dilated cardiomyopathy (DCM)
    472944 (PRKACG)
  Infectious diseases
   05166 HTLV-I infection
    472944 (PRKACG)
   05169 Epstein-Barr virus infection
    472944 (PRKACG)
   05146 Amoebiasis
    472944 (PRKACG)
Enzymes [BR:ptr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     472944 (PRKACG)
Protein kinases [BR:ptr01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   472944 (PRKACG)
Messenger RNA biogenesis [BR:ptr03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     472944 (PRKACG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
9
AA seq 351 aa AA seqDB search
MGNAPAKKDTEQEESVNEFLAKARGDFLYRWGNPAQNTASSDQFERLRTLGMGSFGRVML
VRHRETGGHYAMKILNKQKVVKMKQVEHILNEKRILQAIDFPFLVKLQFSFKDNSYLYLV
MEYVPGGEMFSRLQRVGRFSEPHACFYAAQVVLAFQYLHSLDLIHRDLKPENLLIDQQGY
LQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAVGFSPFY
ADQPIQIYEKIVSGRVRFPSKLSSDLKDLLRSLLQVDLTKRFGNLRNGVGDIKNHKWFAT
TSWIAIYEKKVEAPFIPKYTGPGDASNFDDYEEEELRISINEKCAKEFSEF
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgggcaacgcccccgccaagaaggacaccgagcaggaggagagcgtgaacgagttccta
gccaaagccagaggagatttcctctacagatggggaaaccccgctcaaaacaccgccagc
tcggatcagttcgaacggctcaggacgctgggcatgggctccttcgggcgggtgatgctg
gtgaggcaccgggagaccggcggccactacgccatgaagatcctcaacaagcagaaggtg
gtgaagatgaagcaggtcgagcatatactgaacgagaagcgcatcctgcaggcgatcgac
tttccgttcctcgtcaaactccagttctcctttaaggacaactcctacctgtacctggtg
atggagtacgtgcccggtggggagatgttctcccgcctacagcgcgtcggaaggtttagc
gagccccatgcctgtttctatgccgcccaggtcgtcctggccttccagtacctacactcg
ctcgacctcatccaccgcgacctgaagccagagaatctcctcatcgaccagcagggctac
ctgcaggtgacggacttcggtttcgccaagcgcgtgaagggccgcacttggaccttgtgc
gggaccccagagtacctggcccccgagatcatcctgagcaaaggctacaacaaggccgtg
gactggtgggccctaggggtgctcatctatgagatggccgtgggcttctcacccttctac
gccgaccagcccatccagatctacgagaagatcgtctctgggagggtgcggtttccctcc
aaactcagctctgacctcaaggatctgctgcggagcctgctgcaggtggacctcaccaag
cgcttcggaaacctcaggaacggggttggcgacatcaagaaccacaagtggttcgccaca
accagctggatcgccatctatgagaagaaggtggaagctcccttcatcccgaagtacaca
ggccctggggatgccagtaactttgacgactacgaggaggaggagctccggatctccatc
aatgagaagtgtgccaaggagttttctgagttttag

DBGET integrated database retrieval system