KEGG   Pan troglodytes (chimpanzee): 472944Help
Entry
472944            CDS       T01005                                 

Gene name
PRKACG
Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit gamma
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr01522  Endocrine resistance
ptr04010  MAPK signaling pathway
ptr04014  Ras signaling pathway
ptr04020  Calcium signaling pathway
ptr04024  cAMP signaling pathway
ptr04062  Chemokine signaling pathway
ptr04114  Oocyte meiosis
ptr04140  Autophagy - animal
ptr04211  Longevity regulating pathway
ptr04213  Longevity regulating pathway - multiple species
ptr04261  Adrenergic signaling in cardiomyocytes
ptr04270  Vascular smooth muscle contraction
ptr04310  Wnt signaling pathway
ptr04340  Hedgehog signaling pathway
ptr04371  Apelin signaling pathway
ptr04530  Tight junction
ptr04540  Gap junction
ptr04611  Platelet activation
ptr04713  Circadian entrainment
ptr04714  Thermogenesis
ptr04720  Long-term potentiation
ptr04723  Retrograde endocannabinoid signaling
ptr04724  Glutamatergic synapse
ptr04725  Cholinergic synapse
ptr04726  Serotonergic synapse
ptr04727  GABAergic synapse
ptr04728  Dopaminergic synapse
ptr04740  Olfactory transduction
ptr04742  Taste transduction
ptr04750  Inflammatory mediator regulation of TRP channels
ptr04910  Insulin signaling pathway
ptr04911  Insulin secretion
ptr04912  GnRH signaling pathway
ptr04913  Ovarian steroidogenesis
ptr04914  Progesterone-mediated oocyte maturation
ptr04915  Estrogen signaling pathway
ptr04916  Melanogenesis
ptr04918  Thyroid hormone synthesis
ptr04919  Thyroid hormone signaling pathway
ptr04921  Oxytocin signaling pathway
ptr04922  Glucagon signaling pathway
ptr04923  Regulation of lipolysis in adipocytes
ptr04924  Renin secretion
ptr04925  Aldosterone synthesis and secretion
ptr04926  Relaxin signaling pathway
ptr04927  Cortisol synthesis and secretion
ptr04928  Parathyroid hormone synthesis, secretion and action
ptr04934  Cushing's syndrome
ptr04961  Endocrine and other factor-regulated calcium reabsorption
ptr04962  Vasopressin-regulated water reabsorption
ptr04970  Salivary secretion
ptr04971  Gastric acid secretion
ptr04976  Bile secretion
ptr05012  Parkinson's disease
ptr05020  Prion diseases
ptr05030  Cocaine addiction
ptr05031  Amphetamine addiction
ptr05032  Morphine addiction
ptr05146  Amoebiasis
ptr05165  Human papillomavirus infection
ptr05166  HTLV-I infection
ptr05169  Epstein-Barr virus infection
ptr05200  Pathways in cancer
ptr05203  Viral carcinogenesis
ptr05205  Proteoglycans in cancer
ptr05414  Dilated cardiomyopathy (DCM)
Module
ptr_M00695  cAMP signaling
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    472944 (PRKACG)
   04010 MAPK signaling pathway
    472944 (PRKACG)
   04310 Wnt signaling pathway
    472944 (PRKACG)
   04340 Hedgehog signaling pathway
    472944 (PRKACG)
   04371 Apelin signaling pathway
    472944 (PRKACG)
   04020 Calcium signaling pathway
    472944 (PRKACG)
   04024 cAMP signaling pathway
    472944 (PRKACG)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    472944 (PRKACG)
  Cell growth and death
   04114 Oocyte meiosis
    472944 (PRKACG)
  Cellular community - eukaryotes
   04530 Tight junction
    472944 (PRKACG)
   04540 Gap junction
    472944 (PRKACG)
 Organismal Systems
  Immune system
   04611 Platelet activation
    472944 (PRKACG)
   04062 Chemokine signaling pathway
    472944 (PRKACG)
  Endocrine system
   04911 Insulin secretion
    472944 (PRKACG)
   04910 Insulin signaling pathway
    472944 (PRKACG)
   04922 Glucagon signaling pathway
    472944 (PRKACG)
   04923 Regulation of lipolysis in adipocyte
    472944 (PRKACG)
   04912 GnRH signaling pathway
    472944 (PRKACG)
   04913 Ovarian Steroidogenesis
    472944 (PRKACG)
   04915 Estrogen signaling pathway
    472944 (PRKACG)
   04914 Progesterone-mediated oocyte maturation
    472944 (PRKACG)
   04921 Oxytocin signaling pathway
    472944 (PRKACG)
   04926 Relaxin signaling pathway
    472944 (PRKACG)
   04918 Thyroid hormone synthesis
    472944 (PRKACG)
   04919 Thyroid hormone signaling pathway
    472944 (PRKACG)
   04928 Parathyroid hormone synthesis, secretion and action
    472944 (PRKACG)
   04916 Melanogenesis
    472944 (PRKACG)
   04924 Renin secretion
    472944 (PRKACG)
   04925 Aldosterone synthesis and secretion
    472944 (PRKACG)
   04927 Cortisol synthesis and secretion
    472944 (PRKACG)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    472944 (PRKACG)
   04270 Vascular smooth muscle contraction
    472944 (PRKACG)
  Digestive system
   04970 Salivary secretion
    472944 (PRKACG)
   04971 Gastric acid secretion
    472944 (PRKACG)
   04976 Bile secretion
    472944 (PRKACG)
  Excretory system
   04962 Vasopressin-regulated water reabsorption
    472944 (PRKACG)
   04961 Endocrine and other factor-regulated calcium reabsorption
    472944 (PRKACG)
  Nervous system
   04724 Glutamatergic synapse
    472944 (PRKACG)
   04727 GABAergic synapse
    472944 (PRKACG)
   04725 Cholinergic synapse
    472944 (PRKACG)
   04728 Dopaminergic synapse
    472944 (PRKACG)
   04726 Serotonergic synapse
    472944 (PRKACG)
   04720 Long-term potentiation
    472944 (PRKACG)
   04723 Retrograde endocannabinoid signaling
    472944 (PRKACG)
  Sensory system
   04740 Olfactory transduction
    472944 (PRKACG)
   04742 Taste transduction
    472944 (PRKACG)
   04750 Inflammatory mediator regulation of TRP channels
    472944 (PRKACG)
  Aging
   04211 Longevity regulating pathway - mammal
    472944 (PRKACG)
   04213 Longevity regulating pathway - multiple species
    472944 (PRKACG)
  Environmental adaptation
   04713 Circadian entrainment
    472944 (PRKACG)
   04714 Thermogenesis
    472944 (PRKACG)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    472944 (PRKACG)
   05205 Proteoglycans in cancer
    472944 (PRKACG)
   05203 Viral carcinogenesis
    472944 (PRKACG)
  Neurodegenerative diseases
   05012 Parkinson's disease
    472944 (PRKACG)
   05020 Prion diseases
    472944 (PRKACG)
  Substance dependence
   05030 Cocaine addiction
    472944 (PRKACG)
   05031 Amphetamine addiction
    472944 (PRKACG)
   05032 Morphine addiction
    472944 (PRKACG)
  Cardiovascular diseases
   05414 Dilated cardiomyopathy (DCM)
    472944 (PRKACG)
  Endocrine and metabolic diseases
   04934 Cushing's syndrome
    472944 (PRKACG)
  Infectious diseases
   05166 HTLV-I infection
    472944 (PRKACG)
   05169 Epstein-Barr virus infection
    472944 (PRKACG)
   05165 Human papillomavirus infection
    472944 (PRKACG)
   05146 Amoebiasis
    472944 (PRKACG)
  Drug resistance
   01522 Endocrine resistance
    472944 (PRKACG)
Enzymes [BR:ptr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     472944 (PRKACG)
Protein kinases [BR:ptr01001]
 Serine/threonine kinases: AGC group
  PKA family
   472944 (PRKACG)
Messenger RNA biogenesis [BR:ptr03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     472944 (PRKACG)
Chromosome and associated proteins [BR:ptr03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    472944 (PRKACG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like APH Haspin_kinase Kdo RIO1
Motif
Other DBs
NCBI-GeneID: 472944
NCBI-ProteinID: XP_528314
Ensembl: ENSPTRG00000021003
UniProt: H2QXB9
Position
9
AA seq 351 aa AA seqDB search
MGNAPAKKDTEQEESVNEFLAKARGDFLYRWGNPAQNTASSDQFERLRTLGMGSFGRVML
VRHRETGGHYAMKILNKQKVVKMKQVEHILNEKRILQAIDFPFLVKLQFSFKDNSYLYLV
MEYVPGGEMFSRLQRVGRFSEPHACFYAAQVVLAFQYLHSLDLIHRDLKPENLLIDQQGY
LQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAVGFSPFY
ADQPIQIYEKIVSGRVRFPSKLSSDLKDLLRSLLQVDLTKRFGNLRNGVGDIKNHKWFAT
TSWIAIYEKKVEAPFIPKYTGPGDASNFDDYEEEELRISINEKCAKEFSEF
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgggcaacgcccccgccaagaaggacaccgagcaggaggagagcgtgaacgagttccta
gccaaagccagaggagatttcctctacagatggggaaaccccgctcaaaacaccgccagc
tcggatcagttcgaacggctcaggacgctgggcatgggctccttcgggcgggtgatgctg
gtgaggcaccgggagaccggcggccactacgccatgaagatcctcaacaagcagaaggtg
gtgaagatgaagcaggtcgagcatatactgaacgagaagcgcatcctgcaggcgatcgac
tttccgttcctcgtcaaactccagttctcctttaaggacaactcctacctgtacctggtg
atggagtacgtgcccggtggggagatgttctcccgcctacagcgcgtcggaaggtttagc
gagccccatgcctgtttctatgccgcccaggtcgtcctggccttccagtacctacactcg
ctcgacctcatccaccgcgacctgaagccagagaatctcctcatcgaccagcagggctac
ctgcaggtgacggacttcggtttcgccaagcgcgtgaagggccgcacttggaccttgtgc
gggaccccagagtacctggcccccgagatcatcctgagcaaaggctacaacaaggccgtg
gactggtgggccctaggggtgctcatctatgagatggccgtgggcttctcacccttctac
gccgaccagcccatccagatctacgagaagatcgtctctgggagggtgcggtttccctcc
aaactcagctctgacctcaaggatctgctgcggagcctgctgcaggtggacctcaccaag
cgcttcggaaacctcaggaacggggttggcgacatcaagaaccacaagtggttcgccaca
accagctggatcgccatctatgagaagaaggtggaagctcccttcatcccgaagtacaca
ggccctggggatgccagtaactttgacgactacgaggaggaggagctccggatctccatc
aatgagaagtgtgccaaggagttttctgagttttag

DBGET integrated database retrieval system