KEGG   Pan troglodytes (chimpanzee): 473076Help
Entry
473076            CDS       T01005                                 

Gene name
POMT1
Definition
protein-O-mannosyltransferase 1 (EC:2.4.1.109)
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    473076 (POMT1)
Enzymes [BR:ptr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose---protein mannosyltransferase
     473076 (POMT1)
Glycosyltransferases [BR:ptr01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   473076 (POMT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
9
AA seq 725 aa AA seqDB search
MWGFLKRPVVVTADINLSLVALTGMGLLSRLWRLTYPRAVVFDEVYYGQYISFYMKQIFF
LDDSGPPFGHMVLALGGYLGGFDGNFLWNRIGAEYSSNVPVWSLRLLPALAGALSVPMAY
QIVLELHFSHCAAMGAALLMLIENALITQSRLMLLESVLIFFNLLAVLSYLKFFNCQKHS
PFSLSWWFWLTLTGVACSCAVGIKYMGVFTYVLVLGVAAVHAWHLIGDQTLSNVCVFCHL
LARAVALLVIPVVLYLLFFYVHLILVFRSGPHDQIMSSAFQASLEGGLARITQGQPLEVA
FGSQVTLRNVFGKPVPCWLHSHQDTYPMIYENGRGSSHQQQVTCYPFKDVNNWWIVKDPR
RHQLVVSSPPRPVRHGDMVQLVHGMTTRSLNTHDVAAPLSPHSQEVSCYIDYNISMPAQN
LWRLEIVNRGSDTDVWKSILSEVRFVHVNTSAVLKLSGAHLPDWGYRQLEIVGEKLSRGY
HGSTVWNVEEHRYGASQEQRERERELHSPAQVDVTRNLSFMARFSELQWRMLALRSDDSE
HKYSSSPLEWVTLDTNIAYWLHPRTSAQIHLLGNIVIWVSGSLALAIYALLSLWYLLRRR
RNVHDLPQDAWLRWVLAGALCAGGWAVNYLPFFLMEKTLFLYHYLPALTFQILLLPVVLQ
HISDHLCRSQLQRSVFSALVVAWYSSACHVSNTLRPLTYGDKSLSPHELKALRWKDSWDI
LIRKH
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgtggggatttttgaagcgccctgtagtggtgacggctgacatcaacttgagccttgtg
gccctgactgggatggggttactgagccggctgtggcgactcacctacccgcgggctgtg
gtttttgacgaagtatattatgggcagtacatctctttttacatgaaacaaatcttcttc
ttggatgacagtgggccgccatttggccacatggtgctggccttgggaggttatttagga
ggattcgatggcaattttttgtggaacagaattggagcagaatacagtagcaacgtgcct
gtgtggtccctgcgcctgctgccagcactcgcgggggccttgtcggtccccatggcctac
cagatagtgttggagctccacttttctcattgtgccgccatgggagctgctctgttgatg
cttatcgagaatgctctcatcactcagtcaaggctaatgcttttggaatcagtgttaata
tttttcaatctattggccgtgttgtcctacctgaagttcttcaactgccaaaagcacagc
cctttttctctgagctggtggttctggctaacactgacaggggtcgcttgttcctgtgca
gtgggcatcaagtacatgggtgtgttcacgtacgtgctcgtgctgggtgttgcagctgtc
catgcctggcacctgattggagaccagactttgtccaatgtctgtgtgttctgtcacttg
ctcgcccgagcagtggctttgctggtcatcccggtcgtcctgtacttactgttcttctac
gtccacttgattctagtcttccgctctgggccccacgaccaaatcatgtccagtgccttc
caggccagcttagagggaggactagctcggatcacccagggtcagccactggaggtggcc
ttcgggtcccaggtcactctgaggaacgtctttgggaaacctgtgccctgctggcttcat
tcccaccaggacacctaccccatgatatatgagaacggccgaggcagctcccaccagcaa
caggtgacctgttaccccttcaaagacgtcaataactggtggattgtaaaggatcccagg
aggcaccagctggtggtgagcagccctccgagacctgtgaggcacggggacatggtgcag
ctggtccacggcatgaccacccgctccctgaacacgcatgatgttgcagcccccctgagc
ccccattcacaggaggtctcctgctacattgactataacatctccatgcccgcccagaac
ctctggagactggaaattgtgaacagaggatctgacacagacgtctggaagagcatcctc
tcagaggtccgctttgtgcatgtgaacacttccgctgtcttaaagctgagcggggctcac
ctccctgactgggggtatcggcaactggagatcgtcggggagaagctgtcccggggctac
cacgggagcacggtgtggaacgtggaggagcatcgatacggcgcgagccaggagcagagg
gagcgggaacgggagctgcactcacctgcgcaggtggacgtcaccaggaacctcagcttc
atggcgagattctcggagctgcagtggaggatgctggcgctgagaagtgatgactcggaa
cacaagtacagctccagcccactggagtgggtcaccctggacaccaatatcgcctactgg
ctgcaccccaggaccagcgctcagatccacctacttggaaacatagtgatctgggtttcg
ggcagcctcgctctggccatctacgccctgctgtccttgtggtacctgctccgacggcga
agaaatgtccatgacctccctcaggatgcctggctgcgctgggtgctggctggggcgctg
tgtgccggtggctgggcagtgaactacctcccgttcttcctgatggagaagacactcttc
ctctaccactacctgcccgcactcaccttccaaatccttctgctccctgtggtcctgcag
cacatcagcgaccacctgtgcaggtcccagctccagaggagcgtcttcagcgccctggtg
gtggcctggtactcctccgcatgccacgtgtccaacacgctgcgcccactcacctacggg
gacaagtcactctcgccacatgaactcaaggcccttcgctggaaagacagctgggacatc
ttgatccgaaaacactag

DBGET integrated database retrieval system