KEGG   Pan troglodytes (chimpanzee): 473376Help
Entry
473376            CDS       T01005                                 

Gene name
ART4, ARTC4, DO, Dombrock
Definition
ADP-ribosyltransferase 4 (Dombrock blood group) (EC:2.4.2.31)
Orthology
K06717  
ADP-ribosyltransferase 4 [EC:2.4.2.31]
Organism
ptr  Pan troglodytes (chimpanzee)
Brite
Enzymes [BR:ptr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     473376 (ART4)
Cellular antigens [BR:ptr04090]
 Proteins
  473376 (ART4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
12
AA seq 314 aa AA seqDB search
MGPLINRCKKILLPTTVPPATMRIWLLGGPLPFLLLLSGLQRPTEGSEVAIKIDFDFAPG
SFDDQYQGCSKQVMEKLTQGDYFTKDIEAQKNYFRMWQKAHLAWLNQGKVLPQNMTTTHA
VAILFYTLNSNVHSDFTRAMASVARTPQQYERSFHFKYLHYYLTSAIQLLRKDSIMENGT
LCYEVHYRTKDVHFNAYTGATIRFGQFLSTSLLKEEAQEFGNQTLFTIFTCLGAPVQYFS
LKKEVLIPPYELFKVINMSYHPRGNWLQLRSTGNLSTYNCQLLKASSKKCIPDPIAIASL
SFLTSVIIFSKSRV
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgggtccattgatcaacagatgcaagaagattcttctcccaactactgtacctcctgca
acgatgagaatctggctccttggaggcccgctgccattcctgctgctcctctctggcctg
cagagacccacagagggttctgaggttgcaattaaaatcgactttgacttcgcaccaggt
tcttttgatgatcagtaccaaggctgtagcaaacaggttatggagaaactaactcaaggg
gattatttcacaaaagacatagaagcccagaagaattattttaggatgtggcaaaaagcc
cacttagcctggcttaaccaaggaaaagttctaccccagaacatgactaccacacacgct
gtggctattttgttttatacattgaacagcaatgttcattctgactttactagagccatg
gcctctgttgccaggactccacagcagtatgaacgttcattccacttcaaatatttacac
tactacctcacctcagcaatccagctgctgaggaaagacagcatcatggagaatggcact
ctgtgctatgaggtgcattataggacgaaggatgtccactttaatgcctacacaggggcc
accattcgatttggccaattcctctccacatccctcctgaaagaagaggcacaggagttt
gggaaccagacactatttaccatattcacctgcctgggtgcacctgtacagtacttctcc
ctcaagaaggaagtcttgatccctccctatgagctgtttaaagttataaatatgagctac
cacccaagaggaaactggttgcagttgaggtcaactgggaacctgagcacatataactgt
cagctgctaaaagcttccagcaagaaatgcatccctgatcctatagctattgcatctctc
tcctttttgaccagtgtcatcatcttttccaaaagcagagtataa

DBGET integrated database retrieval system