KEGG   Pan troglodytes (chimpanzee): 473712Help
Entry
473712            CDS       T01005                                 

Definition
histone H2B type W-T-like
Orthology
K11252  
histone H2B
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Alcoholism
Viral carcinogenesis
Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    473712
  Immune diseases
   05322 Systemic lupus erythematosus
    473712
  Substance dependence
   05034 Alcoholism
    473712
Exosome [BR:ptr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   473712
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
X
AA seq 254 aa AA seqDB search
MKKRFSVSNEKKPIVCNRNLPGKKAGWLPGRKVLNLRDRASWLAATRVNVCDLGLRNSFL
DITQKSTSNKRFDKIQHPFMLKTLMPRLPRSTTAIVWSCHLMAAASAMGGPSSETTSEEQ
LITQEPKEANSTTAQKQSKQRKRGRHGPRRCHSNCRGDSFATYFRRVLKQVHQGLSLSRE
AVSVTDSLVHDILDRIATEAGRLARSTKRQTITAWEIRMAVRLLLPGQMGKLAESEGTKA
VLRTSLYAIQQQRK
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagagatttagtgttagtaatgagaaaaagcccattgtgtgcaataggaatcta
ccaggaaaaaaagctggctggctaccaggaagaaaagtcctgaacctgagagatagggca
agctggcttgcagccactagagtaaatgtttgtgatcttggattaagaaatagtttttta
gacataacacaaaaaagcacaagcaacaaaagatttgataaaattcaacaccccttcatg
ttaaaaactctcatgccccggcttccccggtccacaaccgccattgtgtggtcgtgccat
ttaatggccgctgcctccgccatgggtggaccttcctctgagacgacctctgaggaacag
ctgatcacccaggagcccaaagaggccaactccacgacggcccagaagcagagcaagcag
aggaagcgagggcgccatgggccccgcaggtgccactccaactgccgcggggacagcttc
gccacctatttccgccgggtgctgaagcaggttcaccagggcctcagcctttcccgggag
gccgtgagtgtcacggattctttggttcatgacatattggaccgcatcgccaccgaggct
ggtcgcctggcccgctccaccaagcgccagaccatcactgcctgggagatccggatggct
gtgcgcctgctgctgccggggcagatgggcaagctcgccgagtccgaaggcacgaaggct
gtcctcagaacttcactgtatgccatacagcaacagagaaagtga

  All links  
No link information was found.   
DBGET integrated database retrieval system