KEGG   Pan troglodytes (chimpanzee): 473918Help
Entry
473918            CDS       T01005                                 

Gene name
USP25
Definition
ubiquitin specific peptidase 25
Orthology
K11849  
ubiquitin carboxyl-terminal hydrolase 25/28 [EC:3.1.2.15]
Organism
ptr  Pan troglodytes (chimpanzee)
Brite
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     473918 (USP25)
Peptidases [BR:ptr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   473918 (USP25)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
21
AA seq 1055 aa AA seqDB search
MTVEQNVLQQSAAQKHQQTFLNQLREITGINDTQILQQALKDSNGNLELAVAFLTAKNAK
TPQQEETTYYQTALPGNDRYISVGSQADTNVIDLTGDDKDDLQRAIALSLAESNRAFRET
GITDEEQAISRVLEASIAENKACLKRTPTEVWRDSRNPYDRKRQDKVPVGLKNVGNTCWF
SAVIQSLFNLLEFRRLVLNYKPPSNAQDLPRNQKEHRNLPFMRELRYLFALLVGTKRKYV
DPSRAVEILKDAFKSNDSQQQDVSEFTHKLLDWLEDAFQMKAEEETDEEKPKNPMVELFY
GRFLAVGVLEGKKFENTEMFGQYPLQVNGFKDLHECLEAAMIEGEIESLHSENSGKSGQE
HWFTELPPVLTFELSRFEFNQALGRPEKIHNKLEFPQVLYLDRYMHRNREITRIKREEIK
RLKDYLTVLQQRLERYLSYGSGPKRFPLVDVLQYALEFASSKPVCTSPVDDIDASSPPSG
SIPSQTLPSTTEQQGALSSELPSTSPSSVAAISSRSVIHKPFTQSRIPPDLPMHPAPRHI
TEEELSVLESCLHRWRTEIENDTRDLQESISRIHRTIELMYSDKSMIQVPYRLHAVLVHE
GQANAGHYWAYIFDHRESRWMKYNDIAVTKSSWEELVRDSFGGYRNASAYCLMYINDKAQ
FLIQEEFNKETGQPLVGIETLPPDLRDFVEEDNQRFEKELEEWDAQLAQKALQEKLLASQ
KLRESETSVTTAQAAGDPEYLEQPSRSDFSKHLKEETIRIITKASREHEDKSPETVLQSA
IKLEYARLVKLAQEDTPPETDYRLHHVVVYFIQNQAPKKIIEKTLLEQFGDRNLSFDERC
HNIMKVAQAKLEMIKPEEVNLEEYEEWHQDYRKFRETTMYLIIGLENFQRESYIDSLLFL
ICAFQNNKELLSKGLYRGHDEELISHYRRECLLKLNEQAAELFESGEDREVNNGLIIMNE
FIVPFLPLLLVDEMEEKDILAVEDMRNRWCSYLGQEMEPHLQEKLTDFLPKLLDCSMEIK
SFHEPPKLPSYSTHELCERFARIMLSLSRTPADGR
NT seq 3168 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtggagcagaacgtgctgcagcagagcgcggcgcagaagcaccagcagacgttt
ttgaatcaactgagagaaattacggggattaatgacacccagatactacagcaagccttg
aaggatagtaatggaaacttggaattagcagtggctttccttactgcgaagaatgctaag
acccctcagcaggaggagacaacttactaccaaacagcacttcctggcaatgatagatat
atcagtgtgggaagccaagcagatacaaatgtgattgatctcactggagatgataaagat
gatcttcagagagcaattgccttgagtttggccgaatcaaacagggcattcagggagact
ggaataactgatgaggaacaagccattagcagagttcttgaagccagcatagcagagaat
aaagcatgtttgaagaggacacctacagaagtttggagggattctcgaaacccttatgat
agaaaaagacaggacaaagttcccgttgggctaaagaatgttggcaatacttgttggttt
agtgctgttattcagtcattatttaatcttttggaatttagaagattagttctgaattac
aagcctccatcaaatgctcaagatttaccccgaaaccaaaaggaacatcggaatttgcct
tttatgcgtgagctgaggtatctatttgcacttcttgttggtaccaaaaggaagtatgtt
gatccatcaagagcagttgaaattcttaaggatgctttcaaatcaaatgactcacagcag
caagatgtgagtgagtttacacacaaattattagattggttagaagatgccttccaaatg
aaagctgaagaggagacggatgaagagaagccaaagaaccccatggtagagttgttctat
ggcagattcctggctgtgggagtacttgaaggtaaaaaatttgaaaacactgaaatgttt
ggtcagtacccacttcaggtcaatgggttcaaagatctgcatgagtgcctagaagctgca
atgattgaaggagaaattgagtctttacattcagagaattcaggaaaatcaggccaagag
cattggtttactgaattaccacctgtgttaacatttgaattgtcaagatttgaatttaat
caggcattgggaagaccagaaaaaattcacaacaaattagaatttccccaagttttatat
ttggacagatacatgcacagaaacagagaaataacaagaattaagagggaagagatcaag
agactgaaagattacctcacggtattacaacaaaggctagaaagatatttaagctatggt
tccggtcccaaacgattccccttggtagatgttcttcagtatgcattggaatttgcctca
agtaaacctgtttgcacttctcctgttgacgatattgacgctagttccccacctagtggt
tccataccatcacagacattaccaagcacaacagaacaacagggagccctatcttcagaa
ctgccaagcacatcaccttcatcagttgctgccatttcatcgagatcagtaatacacaaa
ccatttactcagtcccggatacctccagatttgcccatgcatccggcaccaaggcacata
acggaggaagaactttctgtgctggaaagttgtttacatcgctggaggacagaaatagaa
aatgacaccagagatttgcaggaaagcatatccagaatccatcgaacaattgaattaatg
tactctgacaaatctatgatacaagttccttatcgattacatgccgttttagttcatgaa
ggccaagctaatgctgggcactactgggcatatatttttgatcatcgcgaaagcagatgg
atgaagtacaatgatattgctgtgacaaaatcatcatgggaagagctagtgagggactct
tttggtggttatagaaatgccagtgcatactgtttaatgtacataaatgataaggcacag
ttcctaatacaagaggagtttaataaagaaactgggcagccccttgttggtatagaaaca
ttaccaccggatttgagagattttgttgaggaagacaaccaacgatttgaaaaagaacta
gaagaatgggatgcacaacttgcccagaaagctttgcaggaaaagcttttagcgtctcag
aaattgagagagtcagagacttctgtgacaacagcacaagcagcaggagacccagaatat
ctagagcagccatcaagaagtgatttctcaaagcacttgaaagaagaaactattcgaata
attaccaaggcatcacgtgagcatgaagataaaagtcctgaaacagttttgcagtcggca
attaagttggaatatgcaaggttggttaagttggcccaagaagataccccaccagaaacc
gattatcgtttacatcatgtagtggtctactttatccagaaccaggcaccaaagaaaatt
attgagaaaacattgctagaacaatttggagatagaaatttgagttttgatgaaaggtgt
cacaacataatgaaagttgctcaagccaaactggaaatgataaaacctgaagaagtaaac
ttggaggaatatgaggagtggcatcaggattataggaaattcagggaaacaactatgtat
ctcataattgggctagaaaattttcaaagagaaagttatatagattccttgctgttcctc
atctgtgcttttcagaataacaaagaactcttgtctaaaggcttatacagaggacatgat
gaagaattgatatcacattatagaagagaatgtttgctaaaattaaatgagcaagccgca
gaactcttcgaatctggagaggatcgagaagtaaacaatggtctgattatcatgaatgag
tttattgtcccatttttgccattattactggtggatgaaatggaagaaaaggatatacta
gctgtagaagatatgagaaatcgatggtgttcctaccttggtcaagaaatggaaccacac
ctccaagaaaagctgacagattttttgccaaaactgcttgattgttctatggagattaaa
agtttccatgagccaccgaagttaccttcatattccacgcatgaactctgtgagcgattt
gcccgaatcatgttgtccctcagtcgaactcctgctgatggaagataa

DBGET integrated database retrieval system