KEGG   Pan troglodytes (chimpanzee): 494122Help
Entry
494122            CDS       T01005                                 

Gene name
PGAM4, PGAM3
Definition
(RefSeq) phosphoglycerate mutase family member 4 (EC:3.1.3.13 5.4.2.4 5.4.2.11)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Metabolic pathways
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Glucagon signaling pathway
Central carbon metabolism in cancer
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    494122 (PGAM4)
   01230 Biosynthesis of amino acids
    494122 (PGAM4)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    494122 (PGAM4)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    494122 (PGAM4)
 Organismal Systems
  Endocrine system
   04922 Glucagon signaling pathway
    494122 (PGAM4)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    494122 (PGAM4)
Enzymes [BR:ptr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     494122 (PGAM4)
Exosome [BR:ptr04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   494122 (PGAM4)
  Exosomal proteins of melanoma cells
   494122 (PGAM4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
X
AA seq 254 aa AA seqDB search
MAAYKLVLIRHGESTWNLENRFSCWYDADLSPAGHEEAKRGGQALRDAGYEFDICLTSVQ
KRVIRTLWTVLDAIDQMWLPVVRTWRLNERHYGGLTALNKAETAAKHGEAQVKIWRRSYD
VPPPPMEPDHPFYSNISKDRRYADLTEDQLPSYESPKDTIARALPFWNEEIVPQIKEGKR
VLIAAHGNSLQGIAKHVEGLSEEAIMELNLPTGIPIVYELDKNLKPIKPMQFLGDEETVC
KAMEAVAAQGKAKK
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggccgcctacaaactggtgctgatccggcacggcgagagcacatggaacctggagaac
cgcttcagctgctggtacgacgccgacctgagcccggcgggccacgaggaggcgaagcgc
ggcgggcaggcgctacgagatgctggctatgagtttgacatctgcctcacctcagtgcag
aagagagtgatccggaccctctggacagtgctagatgccattgatcagatgtggctgcca
gtggtgaggacttggcgcctcaatgagcggcactatgggggtctaaccgctctcaataaa
gcagaaactgctgcaaagcatggtgaggcccaggtgaagatctggaggcgctcctatgat
gtcccaccacctccgatggagcccgaccaccctttctacagcaacatcagtaaggatcgc
aggtatgcagacctcacagaagatcagctaccctcctatgagagtccgaaggatactatt
gccagagctctgcccttctggaatgaagaaatagttccccagatcaaggaggggaaacgt
gtactgattgcagcccatggcaacagcctccagggcattgccaagcatgtggagggtctc
tctgaagaggctatcatggagctgaacctgccgactggtattcccattgtctatgaattg
gacaagaacttgaagcctatcaagcccatgcagtttctgggggatgaagagacggtgtgc
aaagccatggaagctgtggctgcccagggcaaggccaagaagtga

DBGET integrated database retrieval system