KEGG   Pan troglodytes (chimpanzee): 503511Help
Entry
503511            CDS       T01005                                 

Gene name
BDNF
Definition
brain-derived neurotrophic factor
Orthology
K04355  
brain-derived neurotrophic factor
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
MAPK signaling pathway
Neurotrophin signaling pathway
Huntington's disease
Cocaine addiction
Alcoholism
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    503511 (BDNF)
 Organismal Systems
  Nervous system
   04722 Neurotrophin signaling pathway
    503511 (BDNF)
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    503511 (BDNF)
  Substance dependence
   05030 Cocaine addiction
    503511 (BDNF)
   05034 Alcoholism
    503511 (BDNF)
Cytokines [BR:ptr04052]
 PDGF family
  Cysteine-knot growth factors
   Subclass II
    503511 (BDNF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11
AA seq 247 aa AA seqDB search
MTILFLTMVISYFGCMKAAPMKEANIRGQGGLAYPGVRTHGTLESVNGPKAGSRGLTSLA
DTFEHVIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAA
NMSMRVRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQY
FYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCT
LTIKRGR
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgaccatccttttccttactatggttatttcatactttggttgcatgaaggctgccccc
atgaaagaagcaaacatccgaggacaaggtggcttggcctacccaggtgtgcggacccat
gggactctggagagcgtgaatgggcccaaggcaggttcaagaggcttgacatcgttggct
gacactttcgaacacgtgatagaagagctgttggatgaggaccagaaagttcggcccaat
gaagaaaacaataaggacgcagacttgtacacgtccagggtgatgctcagtagtcaagtg
cctttggagcctcctcttctctttctgctggaggaatacaaaaattacctagatgctgca
aacatgtccatgagggtccggcgccactctgaccctgcccgccgaggggagctgagcgtg
tgtgacagtattagcgagtgggttacggcggcggacaaaaagactgcagtggacatgtcg
ggcgggacggtcacagtccttgaaaaggtccctgtatcaaaaggccaactgaagcaatac
ttctacgagaccaagtgcaatcccatgggttacacaaaagaaggctgcaggggcatagac
aaaaggcattggaactcccagtgccgaactacccagtcgtacgtgcgggcccttaccatg
gatagcaaaaagagaattggctggcgattcataaggatagacacttcttgtgtatgtaca
ttgaccattaaaaggggaagatag

DBGET integrated database retrieval system