KEGG   Pan troglodytes (chimpanzee): 735442Help
Entry
735442            CDS       T01005                                 

Gene name
DHFR
Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    735442 (DHFR)
   00670 One carbon pool by folate
    735442 (DHFR)
Enzymes [BR:ptr01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     735442 (DHFR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
5
AA seq 187 aa AA seqDB search
MVGSLNCIVAVSQNMGIGKNGDLPWPPLRNEFRYFQRMTTTSSVEGKQNLVIMGKKTWFS
IPEKNRPLKGRINLVLSRELKEPPQGAHFLSRSLDDALKLTEQPELASKVDMVWIVGGSS
VYKEAMNHPGHLKLFVTRIMQDFESDTFFPEIDLEKYKLLPEYPGVLSDVQEEKGIKYKF
EVYEKND
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atggttggttcgctaaactgcatcgtcgctgtgtcccagaacatgggcatcggcaagaac
ggggacctgccctggccaccgctcaggaatgaattcagatatttccagagaatgaccaca
acctcttcagtagaaggtaaacagaatctggtgattatgggtaagaagacctggttctcc
attcctgagaagaatcgacctttaaagggtagaattaatttagttctcagcagagaactc
aaggaacctccacaaggagctcattttctttccagaagtctagatgatgccttaaaactt
actgaacaaccagaattagcaagtaaagtagacatggtctggatagttggtggcagttct
gtttataaggaagccatgaatcacccaggccatcttaaactatttgtgacaaggatcatg
caagactttgaaagtgacacgttttttccagaaattgatttggagaaatataaacttctg
ccagaatacccaggtgttctctctgatgtccaggaggagaaaggcattaagtacaaattt
gaagtatatgagaagaatgattaa

DBGET integrated database retrieval system