KEGG   Pan troglodytes (chimpanzee): 735835Help
Entry
735835            CDS       T01005                                 

Gene name
USP12, USP12P1
Definition
ubiquitin specific peptidase 12
Orthology
K11842  
ubiquitin carboxyl-terminal hydrolase 12/46 [EC:3.4.19.12]
Organism
ptr  Pan troglodytes (chimpanzee)
Brite
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     735835 (USP12)
Peptidases [BR:ptr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   735835 (USP12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
13
AA seq 370 aa AA seqDB search
MEILMTVSKFASICTMGANASALEKEIGPEQFPVNEHYFGLVNFGNTCYCNSVLQALYFC
RPFREKVLAYKSQPRKKESLLTCLADLFHSIATQKKKVGVIPPKKFITRLRKENELFDNY
MQQDAHEFLNYLLNTIADILQEERKQEKQNGRLPNGNIDNENNNSTPDPTWVHEIFQGTL
TNETRCLTCETISSKDEDFLDLSVDVEQNTSITHCLRGFSNTETLCSEYKYYCEECRSKQ
EAHKRMKVKKLPMILALHLKRFKYMDQLHRYTKLSYRVVFPLELRLFNTSGDATNPDRMY
DLVAVVVHCGSGPNRGHYIAIVKSHDFWLLFDDDIVEKIDAQAIEEFYGLTSDISKNSES
GYILFYQSRD
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atggaaatcctaatgacagtctccaaattcgcctccatctgtaccatgggcgccaatgct
tcggcattagagaaagagattggtccagaacagtttccggtcaatgagcactattttgga
ttagtcaattttgggaatacctgctactgcaattcagttcttcaagcactttatttttgt
cgtccatttcgggaaaaagttcttgcgtataagagtcaacctaggaaaaaggagagcctt
cttacatgcttagcagatctcttccatagcatagccactcagaagaaaaaggttggagta
ataccccctaagaagttcatcacaagattacggaaagaaaacgagctttttgacaactac
atgcaacaagatgcccatgaattcttaaattacctactaaatacaattgctgatatttta
caagaagagagaaagcaggaaaaacaaaatggtcgcttacctaatggtaatattgataat
gaaaataataacagcacaccagacccaacgtgggttcatgagatttttcagggaacatta
actaatgaaaccagatgtcttacttgtgaaactataagcagcaaagatgaagatttttta
gacctttctgttgacgtggaacaaaatacatcaattactcactgcttaagaggtttcagc
aacacagaaactctgtgcagtgaatacaagtattactgtgaagagtgtcgcagcaaacag
gaagcacacaaacggatgaaagttaaaaaactgcccatgattctagctctacacctgaag
agatttaaatatatggatcaacttcatcgatatacaaaactctcttaccgggtagttttt
cctttagaacttcgtctgtttaacacttcaggtgatgccaccaatccagacagaatgtac
gaccttgttgctgttgtggttcactgtggaagtggtcccaatcgaggccattatattgca
atagttaagagtcatgatttttggttgttgtttgatgacgacattgtagaaaaaatagat
gcacaagctattgaagaattctacgggttgacatcagatatctcaaagaactctgagtct
ggttacatccttttctatcagtctcgggactga

DBGET integrated database retrieval system