KEGG   Pan troglodytes (chimpanzee): 735868Help
Entry
735868            CDS       T01005                                 

Gene name
SUV420H2
Definition
(RefSeq) suppressor of variegation 4-20 homolog 2 (Drosophila)
  KO
K11429  
histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    735868 (SUV420H2)
Enzymes [BR:ptr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     735868 (SUV420H2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
19
AA seq 462 aa AA seqDB search
MGPDRVTARELCENDDLATSLVLDPYLGFRTHKMNVSPVPPLRRQQHLRSALETFLRQRD
LEAAYRALTLGGWTARYFQSRGPRQEAALKTHVYRYLRAFLPESGFTILPCTRYSMETNG
AKIVSTRAWKKNEKLELLVGCIAELREADEGLLRAGENDFSIMYSTRKRSAQLWLGPAAF
INHDCKPNCKFVPADGNAACVKVLRDIEPGDEVTCFYGEGFFGEKNEHCECHTCERKGEG
AFRTRPREPTLPPRPLDKYQLRETKRRLQQGLDSGSRQGLLGPRACVHPSPLRRDPFCAA
CQPLSLPACSARPDTSPLWLQWLPQPQPGVRPRKRRRPRPRRAPVLSTHHAARVSLHRWG
GCGPHCRLQGEALVALGQPPHARWAPQQDWHWARRYGLPYVVRVDLRRLAPAPPATPAPA
GTPGPILIPKQALAFAPFSPPKRLRLVVSHGSIDLDVGGGEL
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atggggcccgacagagtgacagcacgagaactgtgcgagaacgacgacctggccaccagc
ctcgtcctggacccctacctcggtttccgcacccataagatgaacgtcagccctgtgccc
cccctgcggcgacagcagcacctgcgctcagcgctggaaactttcctgaggcagcgggac
ctggaggctgcgtaccgggccctgacgctgggaggctggacggcccgctacttccagagc
cggggcccgcggcaggaggctgccctcaagacccacgtctatcgctacctccgtgccttc
ctgccggaaagtggctttaccatcctgccctgcacgcgctactccatggagaccaacggg
gccaagatcgtgtccactcgtgcttggaaaaagaatgagaagctggagctgctggtgggc
tgcattgcagagctgcgggaggcagatgaggggctgctgagggccggtgagaatgacttc
agcatcatgtactcaacccgcaagcggagtgctcagctgtggctgggcccagccgccttc
atcaaccatgactgcaaacccaactgcaagtttgtgcctgcagatgggaacgcagcctgc
gtgaaggtgctccgggacattgagcctggggacgaggtgacatgcttctacggcgagggc
ttcttcggcgagaagaatgagcactgtgaatgccacacctgtgagaggaaaggtgaagga
gctttccgaaccaggcctagggagcccacgttgccaccacggcccctggacaagtaccag
ctgcgtgagaccaagcggcggctgcagcaaggcctggacagtggcagccgacagggcctg
ctgggccctcgggcctgcgtgcacccatccccgctgcgccgggacccattctgcgccgcc
tgccagcccctgagcctgccagcatgcagcgcccgcccagacacctcacccctctggctc
cagtggctgcctcagccccagcccggagtgcggccccggaagcgccgacgcccccggccc
cggagggccccagtgctctccacccaccacgctgcccgcgtctccctgcaccgatgggga
ggctgtggcccccactgccgcctgcaaggagaggccctggtggccctgggccagcccccc
cacgcccgctgggcccctcagcaggactggcactgggcccggcgctatgggctgccttac
gtggtgcgtgtggaccttcgtcgcctggccccagccccaccagccaccccagcccctgct
gggaccccaggccccatcctgatcccgaagcaggccctcgcctttgcccccttctcccca
cccaagcgcctacggctggtggtcagccacggctccatcgacctggatgtcggcggtgga
gagctgtga

DBGET integrated database retrieval system