KEGG   Pan troglodytes (chimpanzee): 735881Help
Entry
735881            CDS       T01005                                 

Definition
cytochrome P450 1A2-like
Orthology
K07409  
cytochrome P450, family 1, subfamily A, polypeptide 2 [EC:1.14.14.1]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Steroid hormone biosynthesis
Caffeine metabolism
Tryptophan metabolism
Linoleic acid metabolism
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Metabolic pathways
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    735881
   00591 Linoleic acid metabolism
    735881
  Amino acid metabolism
   00380 Tryptophan metabolism
    735881
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    735881
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    735881
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    735881
   00982 Drug metabolism - cytochrome P450
    735881
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    735881
Enzymes [BR:ptr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     735881
Cytochrome P450 [BR:ptr00199]
 Cytochrome P450, animal type
  CYP1 family
   735881
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
15
AA seq 493 aa AA seqDB search
GIVPVVPFSATELLLASAIFCLVFWVLKGLRPRVPKGLKSPPEPWGWPLLGHVLTLGKNP
HLALSRMSQRYGDVLQIRIGSTPVLVLSRLDTIRQALVRQGDDFKGRPDLYTSTLITDGQ
SMTFSTDSGPVWAARRRLAQNALNTFSIASDPASSSSCYLEEHVSKEAEALISRLQELMA
GPGHFDPYNQVVMSVANVIGAMCFGQHFPESSDEMLSLVKNTHEFVETASSGNPLDFFPI
LRYLPNPALQRFKAFNQRFLRFLQKTVQEHYQDFDKNSVRDITGALFKHSKKGPRASGGD
LIPQEKIVNLVNDILEQRTAKCAARHKEKFRMEMAVGRLSGWGGGRSNTCPSFPALSLTA
PSSLLSTTRDTTLNGFYIPKKCCVFINQWQVNHDPELWEDPSEFRPERFLTADGTAINKP
LSEKMMLFGMGKRRCIGEVLAKWEVFLFLAILLQQLEFSVPPGVKVDLTPIYGLTMKHAR
CEHVQARLRFSIN
NT seq 1484 nt NT seq  +upstreamnt  +downstreamnt
atggcattgtcccagtcgttcccttctcggccacagagcttctcctggcctctgccatct
tctgcctggtattctgggtgctcaagggtttgaggcctcgggtccccaaaggcctgaaaa
gtccaccagagccatggggctggcccttgctcgggcatgtgctgaccctggggaagaacc
cgcacctggcactgtcaaggatgagccagcgctacggggacgtgctgcagatccgcattg
gctccacgcccgtgctggtgctgagccgcctggacaccatccggcaggccctggtgcggc
agggcgacgatttcaagggccggcctgacctctacacctccaccctcatcactgatggcc
agagcatgaccttcagcacagactctggaccggtgtgggctgcccgccggcgcctggccc
agaacgccctcaacaccttctccatcgcctctgacccagcttcctcatcctcctgctacc
tggaggagcatgtgagcaaggaggctgaggccctgatcagcaggttgcaggagctgatgg
cagggcctgggcacttcgacccttacaatcaggtggtgatgtcagtggccaacgtcatcg
gtgccatgtgcttcggacagcacttccctgagagtagtgatgagatgctcagcctcgtga
agaacactcatgagttcgtggagactgcctcctccgggaaccccctggacttcttcccca
tccttcgctacctgcctaaccctgccctgcagaggttcaaggccttcaaccagaggttcc
tgcggttcctgcagaaaacagtccaggagcactatcaggactttgacaagaacagtgtcc
gggacatcacgggtgccctgttcaagcacagcaagaaggggcctagagccagcggcggcg
acctcatcccacaggagaagattgtcaaccttgtcaatgacatcttggagcagagaacag
ccaagtgcgcagccaggcacaaagagaagtttaggatggagatggcggtgggcaggctgt
cgggatggggtggaggtaggagcaacacatgccccagctttccagccctgagcctcacag
cgccctcttccctcctcagcacaacaagggacacaacgctgaatggcttctacatcccca
agaaatgctgtgtcttcataaaccagtggcaggtcaaccatgacccagagctgtgggagg
acccctctgagttccggcctgagcggttcctcaccgccgatggcactgccattaacaagc
ccttgagtgagaagatgatgctgtttggcatgggcaagcgccggtgtatcggggaagtcc
tggccaagtgggaggtcttcctcttcctggccatcctgctacagcaactggagttcagcg
tgccaccgggcgtgaaagtcgacctgacccccatctacgggctgaccatgaagcacgccc
gctgtgaacacgtccaggcgcggctgcgcttctccatcaactga

DBGET integrated database retrieval system