KEGG   Pan troglodytes (chimpanzee): 736467Help
Entry
736467            CDS       T01005                                 

Gene name
CTRB2
Definition
(RefSeq) chymotrypsinogen B2
  KO
K01310  chymotrypsin [EC:3.4.21.1]
Organism
ptr  Pan troglodytes (chimpanzee)
Brite
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.1  chymotrypsin
     736467 (CTRB2)
Peptidases [BR:ptr01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   736467 (CTRB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin DUF1986
Motif
Other DBs
NCBI-GeneID: 736467
NCBI-ProteinID: XP_024205720
Ensembl: ENSPTRG00000008355
Position
16
AA seq 309 aa AA seqDB search
MAFLWLLSCWALLGTTFGCGVPAIHPVLSGLSRIVNGEDAVPGSWPWQVSLQDKTGFHFC
GGSLISEDWVVTAAHCGVRTSDVVVAGEFDQGSDEENIQVLKIAKVPRPREAEGRAVGTG
GDPSAASGTGAQWGRAGLVIPIPALGMDCSLTGTREGVCPRSLQVLPPPRASPRHSGPHP
QVFKNPKFSILTVNNDITLLKLATPARFSQTVSAVCLPSADDDFPAGTLCATTGWGKTKY
NGRLWRPPGLPKGWSLDPGGHCVLGQRHLLHLQPWRVRPCHQAHTLGAEDPGCQLSPRLP
PTLLPTEPQ
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggctttcctctggctcctctcctgctgggccctcctgggtaccaccttcggctgcggg
gtccccgccatccaccctgtgctcagcggcctgtccaggatcgtgaatggggaggacgcc
gtccccggctcctggccctggcaggtgtccctgcaggacaaaaccggcttccacttctgc
gggggctccctcatcagcgaggactgggtagtcaccgctgcccactgcggggtcaggacc
tccgacgtggtcgtggctggggagtttgaccagggctctgacgaggagaacatccaggtc
ctgaagatcgccaaggtacccaggccccgtgaagcagagggcagggccgtgggcacgggg
ggagacccctcggctgcttcagggacaggcgcccagtggggccgggcaggcctcgtgatt
cccattccggccctggggatggactgctccttaacgggcaccagggaaggagtctgtcct
cgaagcctgcaggtcctgcctcctcccagggcctcaccccggcactctggcccccacccc
caggtcttcaagaaccccaagttcagcattctgaccgtgaacaatgacatcaccctgctg
aagctggccacacctgcccgcttctcccagacagtgtccgccgtgtgcctgcccagtgcg
gacgacgacttccccgcggggacactgtgtgccaccacaggctggggaaagaccaagtac
aatgggcgactctggcggccccctggtctgccaaaaggatggagcctggaccctggtggg
cattgtgtcctggggcagcgacacctgctccacctccagccctggcgtgtacgcccgtgt
caccaagctcataccttgggtgcagaagatcctggctgccaactgagcccgcggctccct
ccgaccctgctccccacagagcctcagtaa

DBGET integrated database retrieval system