KEGG   Pan troglodytes (chimpanzee): 736519Help
Entry
736519            CDS       T01005                                 

Gene name
GALC
Definition
galactosylceramidase
Orthology
K01202  
galactosylceramidase [EC:3.2.1.46]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Sphingolipid metabolism
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    736519 (GALC)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    736519 (GALC)
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.46  galactosylceramidase
     736519 (GALC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
14
AA seq 662 aa AA seqDB search
MAEWLLSASWQRRAKAMTAAAGSAGRAAVPLLLCALLAPGGAYVLDDSDGLGREFDGIGA
VSGGGPNFGASLHILKVEIGGDGQTTDGTEPSHMHYALDENYFRGYEWWLMKEAKKRNPN
ITLIGLPWSFPGWLGKGFDWPYVNLQLTAYYVVTWIVGAKRYHDLDIDYIGIWNERSYNA
NYIKILRKMLNYQGLQRVKIIASDNLWESISASMLLDAELFKVVDVIGAHYPGTHSAKDA
KLTGKKLWSSEDFSTLNSDMGAGCWGRILNQNYINGYMTSTIAWNLVASYYEQLPYGRCG
LMTAQEPWSGHYVVESPVWVSAHTTQFTQPGWYYLKTVGHLEKGGSYVALTDGLGNLTII
IETMSHKHSKCIRPFLPYFNVSQQFATFVLKGSFSEIPELQVWYTKLGKTSERFLFKQLD
SLWLLDSDGSFTLSLHEDELFTLTTLTTGRKGSYPLPPKSQPFPSTYKDDFNVDYPFFSE
APNFADQTGVFEYFTNIEDPGEHHFTLRQVLNQRPITWAADASNTISIIGDYNWTNLTIK
CDVYIETPDTGGVFIAGRVNKGGILIRSARGIFFWIFANGSYRVTGDLAGWIIYALGRVE
VTAKKWYTLTLTIKGHFASGMLNDKSLWTDIPVNFPKNGWAAIGTHSFEFAQFDNFLVEA
TR
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atggctgagtggctactctcggcttcctggcaacgccgagcgaaagctatgactgccgcc
gcgggttcggcgggccgcgccgcggtgcccttgctgctgtgtgcgctgctggcgcccggc
ggcgcgtacgtgctcgacgactccgacgggctgggccgggagttcgacggcatcggcgcg
gtcagcggcggcgggccgaattttggtgcctctttgcatattttaaaagtggaaataggt
ggtgatgggcagacaacagacggcactgagccctcccacatgcactatgcactagatgag
aattatttccgaggatatgagtggtggttgatgaaagaagctaagaagaggaatcccaat
attacactcattgggttgccatggtcattccctggatggctgggaaaaggtttcgactgg
ccttatgtcaatcttcagctgactgcctattatgtcgtgacctggattgtgggcgccaag
cgttaccatgatttggacattgattatattggaatttggaatgagaggtcatataatgcc
aattatattaagatattaagaaaaatgctgaattatcaaggtctccagcgagtgaaaatc
atagcaagtgataatctctgggagtccatctctgcatccatgctccttgatgccgaactg
ttcaaggtggttgatgttataggggctcattatcctggaacccattcagcaaaagatgca
aagttgactgggaagaagctttggtcttctgaagactttagcactttaaatagtgacatg
ggtgcaggctgctggggtcgcattttaaatcagaattatatcaatggctatatgacttcc
acaatcgcatggaatttagtggctagttactatgaacagttgccttatgggagatgcggg
ttgatgacggcccaggagccatggagtgggcactacgtggtagaatctcctgtctgggta
tcagctcataccactcagtttactcaacctggctggtattatctgaagacagttggccat
ttagagaaaggaggaagctacgtagctctgactgatggcttagggaacctcaccatcatc
attgaaaccatgagtcataaacattctaagtgcatacggccatttcttccttatttcaat
gtgtcacaacaatttgccacctttgttcttaagggatcttttagtgaaataccagagcta
caggtatggtataccaaacttggaaaaacatccgaaagatttctttttaagcagctggat
tctctatggctccttgacagcgatggcagtttcacactgagcctgcatgaagatgagctg
ttcacactcaccactctcaccactggtcgcaaaggcagctacccgcttcctccaaaatcc
cagcccttcccaagtacctataaggatgatttcaatgttgattacccattttttagtgaa
gctccaaactttgctgatcaaactggtgtatttgaatattttacaaatattgaagaccct
ggcgagcatcacttcacgctacgccaagttctcaaccagagacccattacgtgggctgcc
gatgcatccaacacaatcagtattataggagactacaactggaccaatctgactataaag
tgtgatgtttacatagagacccctgacacaggaggtgtgttcattgcaggaagagtaaat
aaaggtggtattttgattagaagtgccagaggaattttcttctggatttttgcaaatgga
tcttacagggttacaggtgatttagctggatggattatatatgctttaggacgtgttgaa
gttacagcaaaaaaatggtatacactcacgttgactattaagggtcatttcgcctctggc
atgctgaatgacaagtctctgtggacagacatccctgtgaattttccaaagaatggctgg
gctgcaattggaactcactcctttgaatttgcacagtttgacaactttcttgtggaagcc
acacgctaa

DBGET integrated database retrieval system