KEGG   Pan troglodytes (chimpanzee): 737263Help
Entry
737263            CDS       T01005                                 

Gene name
CYP3A7, CYP3A67
Definition
cytochrome P450, family 3, subfamily A, polypeptide 67
Orthology
K17691  
cytochrome P450, family 3, subfamily A, polypeptide 7 [EC:1.14.14.1]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Steroid hormone biosynthesis
Retinol metabolism
Chemical carcinogenesis
Class
Metabolism; Lipid metabolism; Steroid hormone biosynthesis [PATH:ptr00140]
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:ptr00830]
Human Diseases; Cancers; Chemical carcinogenesis [PATH:ptr05204]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
7
AA seq 503 aa AA seqDB search
MDLIPNLAVETWLLLAVSLILLYLYGTHSHGLFKKLGIPGPTPLPFVGNVWSFRKGFWTF
DMECYKKYRKVWGFYDGLQPVLAITDPDMIKTVLVKECYSVFTNRRPLGPVGFMKSAISR
AEDEEWKRIRSLLSPTFTSGKLKEMVPIIAQYGDVLVRNLRREADTGMPVTLKDVFGAYS
MDVITSTSFGVNIDSLNNPQDPFVENTKKLLRFNSLDPFILSIKIFPFLTPILEALNITV
FPRKVTSFLTKSVKRIKEGRLKETQKHRVDFLQLMIDSQNSKDMESHKALSDLELVAQSI
VFIFAGYETTSSVLSFIIYELATHPDVQQKLQEEIDAVLPNKAPPTYDTVLQLEYLDMVV
NETLRLFPVAMRLERVCKKDVEINGMFIPKGVVVMIPSYVLHHDPKYWTEPEKFLPERFS
KKNKDNIDPYIYTPFGNGPRNCIGMRFALMNMKFALVRVLQNFSFKPCKETQIPLKLRFG
GLLRTEKPIVLMAESRDETVSGA
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggatctcatcccaaacttggccgtggaaacctggcttctcctggctgtcagcctgata
ctcctctatctatatggaacccattcacatggactttttaagaagcttggaattccaggg
cccacacctctgccttttgtgggaaatgtttggtccttccgtaagggcttttggacgttt
gacatggaatgttataaaaagtacagaaaagtctggggtttttatgatggtctacagcct
gtgctggctatcacagaccccgacatgatcaaaacagtgctagtgaaagaatgttattct
gtcttcacaaaccggaggcctttgggtccggtgggatttatgaaaagtgccatatctaga
gctgaggatgaagaatggaagagaatacgatcattgctgtctccaaccttcaccagtgga
aaactcaaggagatggtccctatcattgcccagtatggagatgtgttggtgagaaatctg
aggcgggaagcagacacaggcatgcccgtcaccttgaaagatgtctttggggcctacagc
atggatgtgatcactagcacatcatttggagtgaatatcgactctctcaacaatccacaa
gacccctttgtggaaaacaccaagaagcttttaagatttaattcattagatccattcatt
ctctcaataaaaatctttccattccttaccccaattcttgaagcattaaatatcactgtg
tttccaagaaaagttacaagttttctaacaaaatctgtaaaacggataaaagaaggtcgc
ctcaaagagacacaaaagcaccgagtggatttccttcagctgatgattgactctcagaat
tcgaaagacatggagtcccacaaagctctgtctgatctggagctcgtggcccaatcaatt
gtctttatttttgctggctatgaaaccacgagcagtgttctctccttcattatatatgaa
ctggccactcaccctgatgtccagcagaaactgcaggaggaaattgatgcagttttaccc
aataaggcaccacccacctatgatactgtgctacagttggagtatcttgacatggtggtg
aatgaaacactcagattattcccagttgctatgagacttgagagggtctgcaaaaaagat
gttgagatcaatgggatgttcattcccaaaggggtggtggtgatgattccaagctatgtt
cttcatcatgacccaaagtactggacagagcctgagaagttcctccctgaaaggttcagt
aagaagaacaaggacaacatagatccttacatatacacaccctttggaaatggacccaga
aattgcattggcatgaggtttgctctcatgaacatgaaatttgctctagtcagagtcctt
cagaacttctccttcaaaccttgtaaagaaacacagatccccctgaaattacgctttgga
ggacttcttcgaacagaaaaacccattgttctaatggctgagtcaagggatgagactgtg
agtggagcctga

DBGET integrated database retrieval system