KEGG   Pan troglodytes (chimpanzee): 737263Help
Entry
737263            CDS       T01005                                 

Gene name
CYP3A7, CYP3A67
Definition
cytochrome P450, family 3, subfamily A, polypeptide 67
Orthology
K17691  
cytochrome P450, family 3, subfamily A, polypeptide 7 [EC:1.14.14.1]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Steroid hormone biosynthesis
Retinol metabolism
Metabolic pathways
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    737263 (CYP3A7)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    737263 (CYP3A7)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    737263 (CYP3A7)
Enzymes [BR:ptr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     737263 (CYP3A7)
Cytochrome P450 [BR:ptr00199]
 Cytochrome P450, animal type
  CYP3 family
   737263 (CYP3A7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
7
AA seq 503 aa AA seqDB search
MDLIPNLAVETWLLLAVSLILLYLYGTHSHGLFKKLGIPGPTPLPFVGNVWSFRKGFWTF
DMECYKKYRKVWGFYDGLQPVLAITDPDMIKTVLVKECYSVFTNRRPLGPVGFMKSAISR
AEDEEWKRIRSLLSPTFTSGKLKEMVPIIAQYGDVLVRNLRREADTGMPVTLKDVFGAYS
MDVITSTSFGVNIDSLNNPQDPFVENTKKLLRFNSLDPFILSIKIFPFLTPILEALNITV
FPRKVTSFLTKSVKRIKEGRLKETQKHRVDFLQLMIDSQNSKDMESHKALSDLELVAQSI
VFIFAGYETTSSVLSFIIYELATHPDVQQKLQEEIDAVLPNKAPPTYDTVLQLEYLDMVV
NETLRLFPVAMRLERVCKKDVEINGMFIPKGVVVMIPSYVLHHDPKYWTEPEKFLPERFS
KKNKDNIDPYIYTPFGNGPRNCIGMRFALMNMKFALVRVLQNFSFKPCKETQIPLKLRFG
GLLRTEKPIVLMAESRDETVSGA
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggatctcatcccaaacttggccgtggaaacctggcttctcctggctgtcagcctgata
ctcctctatctatatggaacccattcacatggactttttaagaagcttggaattccaggg
cccacacctctgccttttgtgggaaatgtttggtccttccgtaagggcttttggacgttt
gacatggaatgttataaaaagtacagaaaagtctggggtttttatgatggtctacagcct
gtgctggctatcacagaccccgacatgatcaaaacagtgctagtgaaagaatgttattct
gtcttcacaaaccggaggcctttgggtccggtgggatttatgaaaagtgccatatctaga
gctgaggatgaagaatggaagagaatacgatcattgctgtctccaaccttcaccagtgga
aaactcaaggagatggtccctatcattgcccagtatggagatgtgttggtgagaaatctg
aggcgggaagcagacacaggcatgcccgtcaccttgaaagatgtctttggggcctacagc
atggatgtgatcactagcacatcatttggagtgaatatcgactctctcaacaatccacaa
gacccctttgtggaaaacaccaagaagcttttaagatttaattcattagatccattcatt
ctctcaataaaaatctttccattccttaccccaattcttgaagcattaaatatcactgtg
tttccaagaaaagttacaagttttctaacaaaatctgtaaaacggataaaagaaggtcgc
ctcaaagagacacaaaagcaccgagtggatttccttcagctgatgattgactctcagaat
tcgaaagacatggagtcccacaaagctctgtctgatctggagctcgtggcccaatcaatt
gtctttatttttgctggctatgaaaccacgagcagtgttctctccttcattatatatgaa
ctggccactcaccctgatgtccagcagaaactgcaggaggaaattgatgcagttttaccc
aataaggcaccacccacctatgatactgtgctacagttggagtatcttgacatggtggtg
aatgaaacactcagattattcccagttgctatgagacttgagagggtctgcaaaaaagat
gttgagatcaatgggatgttcattcccaaaggggtggtggtgatgattccaagctatgtt
cttcatcatgacccaaagtactggacagagcctgagaagttcctccctgaaaggttcagt
aagaagaacaaggacaacatagatccttacatatacacaccctttggaaatggacccaga
aattgcattggcatgaggtttgctctcatgaacatgaaatttgctctagtcagagtcctt
cagaacttctccttcaaaccttgtaaagaaacacagatccccctgaaattacgctttgga
ggacttcttcgaacagaaaaacccattgttctaatggctgagtcaagggatgagactgtg
agtggagcctga

DBGET integrated database retrieval system