KEGG   Pan troglodytes (chimpanzee): 737767Help
Entry
737767            CDS       T01005                                 

Gene name
PGAM2
Definition
phosphoglycerate mutase 2 (muscle)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Metabolic pathways
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Glucagon signaling pathway
Central carbon metabolism in cancer
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    737767 (PGAM2)
   01230 Biosynthesis of amino acids
    737767 (PGAM2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    737767 (PGAM2)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    737767 (PGAM2)
 Organismal Systems
  Endocrine system
   04922 Glucagon signaling pathway
    737767 (PGAM2)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    737767 (PGAM2)
Enzymes [BR:ptr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     737767 (PGAM2)
Exosome [BR:ptr04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   737767 (PGAM2)
  Exosomal proteins of melanoma cells
   737767 (PGAM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
7
AA seq 253 aa AA seqDB search
MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKAIKDAKMEFDICYTSVL
KRAIRTLWAILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEEQVKIWRRSFD
IPPPPMDEKHPYYNSISKERRYAGLKPGELPTCESLKDTIARALPFWNEEIVPQIKAGKR
VLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVYELNKELKPTKPMQFLGDEETVR
KAMEAVAAQGKAK
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atggccactcaccgcctcgtgatggtccggcacggcgagagcacatggaaccaggagaac
cgtttctgtggctggttcgatgcagagctgagtgaaaaggggaccgaggaggccaagcgg
ggagccaaggccatcaaggatgccaagatggagtttgacatctgctacacgtcagtgctg
aagcgggccatccgcaccctctgggccatcctggacggcacggaccagatgtggctgccc
gtggtgcgcacttggcgcctcaatgagcggcattacgggggcctcacaggcctcaacaag
gcagaaacggccgccaagcacggggaggagcaggtgaagatctggaggcgctccttcgac
atcccgccgcccccgatggacgagaagcacccctactacaactccattagcaaggagcgt
cggtacgcaggcctgaagcccggggaactccccacctgcgagagcctcaaggacaccatt
gcccgggccctgcccttctggaacgaggagattgttccccagatcaaggccggcaagcga
gtgctcattgcagcccacgggaacagcctgcggggcattgtcaagcacctggaagggatg
tcagaccaggcgatcatggagctgaacctgcccacggggatccccattgtgtatgagctg
aacaaggagctgaagcccaccaagcccatgcagttcctgggtgatgaggaaacggtgcgg
aaggccatggaggctgtggctgcccagggcaaggccaagtga

DBGET integrated database retrieval system