KEGG   Pan troglodytes (chimpanzee): 737923Help
Entry
737923            CDS       T01005                                 

Gene name
GCK
Definition
glucokinase (hexokinase 4)
Orthology
K12407  
glucokinase [EC:2.7.1.2]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Butirosin and neomycin biosynthesis
Metabolic pathways
Carbon metabolism
Insulin signaling pathway
Insulin secretion
Prolactin signaling pathway
Type II diabetes mellitus
Maturity onset diabetes of the young
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    737923 (GCK)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    737923 (GCK)
   00052 Galactose metabolism
    737923 (GCK)
   00500 Starch and sucrose metabolism
    737923 (GCK)
   00520 Amino sugar and nucleotide sugar metabolism
    737923 (GCK)
  Biosynthesis of other secondary metabolites
   00524 Butirosin and neomycin biosynthesis
    737923 (GCK)
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    737923 (GCK)
   04910 Insulin signaling pathway
    737923 (GCK)
   04917 Prolactin signaling pathway
    737923 (GCK)
 Human Diseases
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    737923 (GCK)
   04950 Maturity onset diabetes of the young
    737923 (GCK)
Enzymes [BR:ptr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     737923 (GCK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
7
AA seq 464 aa AA seqDB search
MPRPRSQLPQPNSQVEQILAEFQLQEEDLKKVMRRMQKEMDRGLRLETHEEASVKMLPTY
VRSTPEGSEVGDFLSLDLGGTNFRVMLVKVGEGEEGQWSVKTKHQMYSIPEDAMTGTAEM
LFDYISECISDFLDKHQMKHKKLPLGFTFSFPVRHEDIDKGILLNWTKGFKASGAEGNNV
VGLLRDAIKRRGDFEMDVVAMVNDTVATMISCYYEDHQCEVGMIVGTGCNACYMEEMQNV
ELVEGDEGRMCVNTEWGAFGDSGELDEFLLEYDRLVDESSANPGQQLYEKLIGGKYMGEL
VRLVLLRLVDENLLFHGKASEQLRTRGAFETRFVSQVESDTGDRKQIYNILSTLGLRPST
TDCDIVRRACESVSTRAAHMCSAGLAGVINRMRESRSEDVMRITVGVDGSVYKLHPSFKE
RFHASVRRLTPSCEITFIESEEGSGRGAALVSAVACKKACMLGQ
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgcccagaccaagatcccaactcccacaacccaactcccaggtagagcagatcctggca
gagttccagctgcaggaggaggacctgaagaaggtgatgagacggatgcagaaggagatg
gaccgtggcctgaggctggagacccatgaagaggccagtgtgaagatgctgcccacctac
gtgcgctccaccccagaaggctcagaagtcggggacttcctctccctggacctgggtggc
actaacttcagggtgatgctggtgaaggtgggagaaggtgaggaggggcagtggagcgtg
aagaccaaacaccagatgtactccatccccgaggacgccatgaccggcactgctgagatg
ctcttcgactacatctctgagtgcatctccgacttcctggacaagcatcagatgaagcac
aagaagctgcccctgggcttcaccttctcctttcctgtgaggcacgaagacatcgataag
ggcatccttctcaactggaccaagggcttcaaggcctcaggagcagaagggaacaatgtc
gtggggcttctgcgagacgctatcaaacggagaggggactttgaaatggatgtggtggca
atggtgaatgacacggtggccacgatgatctcctgctactacgaagaccatcagtgcgag
gtcggcatgatcgtgggcacgggctgcaatgcctgctacatggaggagatgcagaatgtg
gagctggtggagggggacgagggccgcatgtgcgtcaataccgagtggggcgccttcggg
gactccggcgagctggacgagttcctgctggagtatgaccgcctggtggacgagagctct
gcaaaccccggtcagcagctgtatgagaagctcataggtggcaagtacatgggcgagctg
gtgcggctcgtgctgctcaggctcgtggacgaaaacctgctcttccacgggaaggcctcc
gagcagctgcgcacacgcggagccttcgagacgcgcttcgtgtcgcaggtggagagcgac
acgggcgaccgcaagcagatctacaacatcctgagcacgctggggctgcgaccctcgacc
accgactgcgacatcgtgcgccgcgcctgcgagagcgtgtctacgcgcgctgcgcacatg
tgctcggcggggctggcgggcgtcatcaaccgcatgcgcgagagccgcagcgaggacgta
atgcgcatcactgtgggcgtggatggctccgtgtacaagctgcaccccagcttcaaggag
cggttccatgccagcgtgcgcaggctgacgcccagctgcgagatcaccttcatcgagtcg
gaggagggcagtggccggggtgcggccctggtctcggcggtggcctgtaagaaggcctgt
atgctgggccagtga

DBGET integrated database retrieval system