KEGG   Pan troglodytes (chimpanzee): 737927Help
Entry
737927            CDS       T01005                                 

Gene name
OTUD5
Definition
OTU domain containing 5
Orthology
K12655  
OTU domain-containing protein 5 [EC:3.4.19.12]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Organismal Systems
  Immune system
   04622 RIG-I-like receptor signaling pathway
    737927 (OTUD5)
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     737927 (OTUD5)
Peptidases [BR:ptr01002]
 Cysteine Peptidases
  Family C85: DUBA deubiquitinylating enzyme
   737927 (OTUD5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
X
AA seq 571 aa AA seqDB search
MTILPKKKPPPPDADPANEPPPPGPLPPAPRRGGGVGVGGGGTGVGGGDRDRDSGVVGAR
PRASPPPQGPLPGPPGALHRWALAVPPGAVAGPRPQQASPPPCGGPGGPGGGPGDALGAA
AAGVGAAGVVVGVGGAVGVGGCCSGPGHSKRRRQAPGVGAVGGGSPEREEVGAGYNSEDE
YEAAAARIEAMDPATVEQQEHWFEKALRDKKGFIIKQMKEDGACLFRAVADQVYGDQDMH
EVVRKHCMDYLMKNADYFSNYVTEDFTTYINRKRKNNCHGNHIEMQAMAEMYNRPVEVYQ
YSTEPINTFHGIHQNEDEPIRVSYHRNIHYNSVVNPNKATIGVGLGLPSFKPGFAEQSLM
KNAIKTSEESWIEQQMLEDKKRATDWEATNEAIEEQVARESYLQWDGSQEGHGCWWSLTH
LPSPLQPRKASATCSSATAAASSGLEEWTSRSPRQRSSASSPEHPELHAELGMKPPSPGT
VLALAKPPSPCAPGTSSQFSAGADRATSPLVSLYPALECRALIQQMSPSAFGLNDWDDDE
ILASVLAVSQQEYLDSMKKNKVHRDPPPDKS
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atgactatactccccaaaaagaagccgccgcctcccgacgccgaccccgccaacgagccg
ccgccgcccgggccgctgcccccggcgccgcggcgcggcgggggtgtgggcgtgggcggc
ggcggcacgggcgtgggcggcggcgatcgcgaccgtgactccggcgtcgtgggggcccgt
ccgcgagcttcgccaccgcctcaaggcccgctaccaggaccgccgggcgctcttcatcgc
tgggcgctggccgtgccgcctggtgcagtggcgggtccccggccacaacaggcttctcca
cctccttgcgggggcccaggtggtcccggcggcggtcccggcgacgcgctgggagcagcg
gcggcgggtgtgggtgccgcgggcgtggtggtgggtgtgggtggtgccgtaggcgtgggc
ggctgctgctccgggcctgggcacagcaagcggcgacgtcaagctcccggggttggcgcg
gttggcgggggcagtcccgagcgtgaggaggtcggcgcaggctacaacagtgaggacgag
tatgaggcggctgcagcacgcatcgaggctatggaccctgccactgtcgagcagcaggag
cattggtttgaaaaggccctacgagacaagaagggcttcatcatcaagcagatgaaggag
gatggcgcctgtctcttccgggctgtagctgaccaggtgtatggagaccaggacatgcat
gaggttgtgcgaaagcattgcatggactatctgatgaagaatgccgactacttctccaac
tatgtcacagaggactttaccacctacattaacaggaagcggaaaaacaattgccatggc
aaccacattgagatgcaggccatggcagagatgtacaaccgtcctgtggaggtgtaccag
tatagcacagaacccatcaacacattccatgggatacatcaaaacgaggacgaacccatt
cgtgttagctaccatcggaatatccactataattcagtggtgaatcctaacaaggccacc
attggtgtggggctgggcctgccatcattcaaaccagggtttgcagagcagtctctgatg
aagaatgccataaaaacatcggaggagtcatggattgaacagcagatgctagaagacaag
aaacgggccacggactgggaggccacaaatgaggccatcgaggagcaggtggctcgggaa
tcctacctgcagtgggatgggtcacaagaaggtcatggctgctggtggtccttaacgcat
ttaccttccccgctgcagccccggaaagccagcgccacatgcagttcggccacagcagca
gcctccagtggcctggaggagtggactagccggtccccgcggcagcggagttcagcctcg
tcacctgagcaccctgagctgcatgctgaattgggcatgaagcccccttccccaggcact
gttttagctcttgccaaacctccttcgccctgtgcgccaggtacaagcagtcagttctcg
gcaggggccgaccgggcaacttccccccttgtgtccctctaccctgctttggagtgccgg
gccctcattcagcagatgtccccctctgcctttggtctgaatgactgggatgatgatgag
atcctagcgtcggtgctggcagtgtcccaacaggaatacctagacagtatgaagaaaaac
aaagtgcacagagacccgcccccagacaagagttga

  All links  
No link information was found.   
DBGET integrated database retrieval system