KEGG   Pan troglodytes (chimpanzee): 737948Help
Entry
737948            CDS       T01005                                 

Gene name
PDE4DIP
Definition
phosphodiesterase 4D interacting protein
Orthology
K05759  
profilin
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Rap1 signaling pathway
Regulation of actin cytoskeleton
Salmonella infection
Class
Environmental Information Processing; Signal transduction; Rap1 signaling pathway [PATH:ptr04015]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:ptr04810]
Human Diseases; Infectious diseases; Salmonella infection [PATH:ptr05132]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 66 aa AA seqDB search
MNGLTLGGQKYTVVLDSLLQDGELTTDLRMKSIGGAPTFNVIVTMTAKTLGLLMGKEGIH
GNFINK
NT seq 201 nt NT seq  +upstreamnt  +downstreamnt
atgaatgggctgacactggggggccagaaatatactgtggtcctggactcactgctgcag
gatggggaattgaccacggatcttcgtatgaagagtatcggtggagcccccaccttcaac
gtcattgtcaccatgactgccaagacgctaggcctgctgatgggcaaagaaggtatccat
ggcaatttcatcaacaagtaa

DBGET integrated database retrieval system