KEGG   Pan troglodytes (chimpanzee): 737948Help
Entry
737948            CDS       T01005                                 

Gene name
PDE4DIP
Definition
(RefSeq) profilin-1
  KO
K05759  
profilin
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Rap1 signaling pathway
Regulation of actin cytoskeleton
Salmonella infection
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    737948 (PDE4DIP)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    737948 (PDE4DIP)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    737948 (PDE4DIP)
Membrane trafficking [BR:ptr04131]
 Others
  Actin-binding proteins
   Others
    737948 (PDE4DIP)
Cytoskeleton proteins [BR:ptr04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Profilin
     737948 (PDE4DIP)
Exosome [BR:ptr04147]
 Exosomal proteins
  Proteins found in most exosomes
   737948 (PDE4DIP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
1
AA seq 156 aa AA seqDB search
PRRPQQQRPEEPLQQPNGQVDTSIYSLVADGTCXDTAIVGNKDPPSIWAAVPGKTFLNIT
PAEVGVLVGKDWSSFVMNGLTLGGQKYTVVLDSLLQDGELTTDLRMKSIGGAPTFNVIVT
MTAKTLGLLMGKEGIHGNFINKXCYEMASHLQRSQY
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
cccaggcggccccagcagcagcgaccagaggagcccctgcagcaacccaacggccaggtg
gacacctccatctacagcctcgtggcggacgggacctgttaggacacggccattgtgggc
aacaaggacccaccttccatctgggctgccgtcccagggaaaaccttcctcaacatcacg
ccagctgaggttggtgtcctggttggcaaagactggtcaagctttgtcatgaatgggctg
acactggggggccagaaatatactgtggtcctggactcactgctgcaggatggggaattg
accacggatcttcgtatgaagagtatcggtggagcccccaccttcaacgtcattgtcacc
atgactgccaagacgctaggcctgctgatgggcaaagaaggtatccatggcaatttcatc
aacaagtaatgttatgaaatggcctcccaccttcagcgttcccagtactga

DBGET integrated database retrieval system