KEGG   Pan troglodytes (chimpanzee): 738821Help
Entry
738821            CDS       T01005                                 

Gene name
SPHK1
Definition
(RefSeq) sphingosine kinase 1 isoform X1
  KO
K04718  sphingosine kinase [EC:2.7.1.91]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr00600  Sphingolipid metabolism
ptr01100  Metabolic pathways
ptr04020  Calcium signaling pathway
ptr04071  Sphingolipid signaling pathway
ptr04072  Phospholipase D signaling pathway
ptr04370  VEGF signaling pathway
ptr04371  Apelin signaling pathway
ptr04666  Fc gamma R-mediated phagocytosis
ptr05152  Tuberculosis
Module
ptr_M00100  Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    738821 (SPHK1)
 Environmental Information Processing
  Signal transduction
   04370 VEGF signaling pathway
    738821 (SPHK1)
   04371 Apelin signaling pathway
    738821 (SPHK1)
   04020 Calcium signaling pathway
    738821 (SPHK1)
   04072 Phospholipase D signaling pathway
    738821 (SPHK1)
   04071 Sphingolipid signaling pathway
    738821 (SPHK1)
 Organismal Systems
  Immune system
   04666 Fc gamma R-mediated phagocytosis
    738821 (SPHK1)
 Human Diseases
  Infectious diseases
   05152 Tuberculosis
    738821 (SPHK1)
Enzymes [BR:ptr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     738821 (SPHK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAGK_cat
Motif
Other DBs
NCBI-GeneID: 738821
NCBI-ProteinID: XP_016788435
Ensembl: ENSPTRG00000009679
UniProt: K7ABY4
Position
17
AA seq 470 aa AA seqDB search
MSAQVLGFLRSWTPLPLAAPRGPAAAGNDAGAPTATAPGGEGEPHSRPCDARLGSTDKEL
KAGAAATGSAPTAPGTPWQREPRVEVMDPAGGPRGVLPRPCRVLVLLNPRGGKGKALQLF
RSHVQPLLAEAEISFTLMLTERRNHARELVRSEELGRWDALVVMSGDGLMHEVVNGLMER
PDWETAIQKPLCSLPAGSGNALAASLNHYAGYEQVTNEDLLTNCTLLLCRRLLSPMNLLS
LHTASGLRLFSVLSLAWGFIADVDLESEKYRRLGEMRFTLGTFLRLAALRTYRGRLAYLP
VGRVGSKTPASPVVVQQGPVDAHLVPLEEPVPSHWTVVPDEDFVLVLALLHSHLGSEMFA
APMGRCAAGVMHLFYVRAGVSRAMLLRLFLAMEKGRHMEYECPYLVYVPVVAFRLEPKDG
KGVFAVDGELMVSEAVQGQVHPNYFWMVSGCVEPPPSWKPQQTPPPEEPL
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgtccgctcaagttctgggatttttacgcagctggactcccctccccctggcagccccg
aggggtccagccgccgcagggaatgacgccggtgctcctacagccacggctccgggcggg
gaaggcgagccccacagccggccctgcgacgcccgcctgggcagcaccgataaggagctg
aaggcaggagccgccgccacgggcagcgcccccacagcgccagggaccccctggcagcgg
gagccgcgggtcgaggttatggatccagcgggcggcccccgcggcgtgctcccgcggccc
tgccgcgtgctggtgctgctgaacccgcgcggcggcaagggcaaggccttgcagctcttc
cggagtcacgtgcagccccttttggctgaggctgaaatctccttcacgctgatgctcact
gagcggcggaaccacgcgcgggagctggtgcggtcggaggagctgggccgctgggacgct
ctggtggtcatgtctggagacgggctgatgcacgaggtggtgaacgggctcatggagcgg
cctgactgggagaccgccatccagaagcccctgtgtagcctcccagcaggctctggcaac
gcgctggcagcttccttgaaccattatgctggttatgagcaggtcaccaatgaagacctc
ctgaccaactgcacgctattgctgtgccgccggctgctgtcgcccatgaacctgctgtct
ctgcacacggcttcggggctgcgcctcttctctgtgctcagcctggcctggggcttcatt
gctgatgtggacctagagagtgagaagtatcggcgtctgggggagatgcgcttcactctg
ggcaccttcctgcgtctggcagccctgcgcacctaccgtggccgactggcctacctccct
gtaggaagagtcggttccaagacacctgcctcccccgttgtggtccagcagggcccggta
gatgcacaccttgtgccactggaggagccagtgccctctcactggacagtggtgcccgac
gaggactttgtgctagtcctggcactgctgcactcgcacctgggcagtgagatgtttgct
gcacccatgggccgctgtgcagctggcgtcatgcatctgttctacgtgcgggcgggagtg
tctcgcgccatgctgctgcgcctcttcctggccatggagaagggcaggcatatggagtat
gaatgcccctacttggtatatgtgcccgtggtcgccttccgcttggagcccaaggatggg
aaaggtgtgtttgcagtggatggggaattgatggttagcgaggccgtgcagggccaggtg
cacccaaactacttctggatggtcagtggttgcgtggagcccccgcccagctggaagccc
cagcagacgccaccgccagaagagcccttatga

DBGET integrated database retrieval system