KEGG   Pan troglodytes (chimpanzee): 738883Help
Entry
738883            CDS       T01005                                 

Definition
cytochrome P450 2F1-like
Orthology
K07416  
cytochrome P450, family 2, subfamily F [EC:1.14.14.1]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Metabolism of xenobiotics by cytochrome P450
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    738883
Enzymes [BR:ptr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     738883
Cytochrome P450 [BR:ptr00199]
 Cytochrome P450, animal type
  CYP2 family
   738883
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
19
AA seq 367 aa AA seqDB search
MTLPVQVHQMQGGGDRTLEKRILEGGQLLLAELRKPSGEPFDPTFVLSRSVSNIICSVLF
GSRFDYDDERLLTIIRLINDNFQIMSSPWGELYNIFPSLLNWVPGPHQRIFQNFKCLRDL
IAHSVHDHQASLDPRSPRDFIDCFLTKMAEKKEDPLSHFHMDTLLMTTHNLLFGGTETVG
TTLRHAFLALMKYPKVQARVQEEIDLVVGRARLPALKDRAAMPYTDAVIHEVQRFADIIP
MNLPHRVTRDTAFRGFLIPKGTDVITLLNTVHYDPSQFLTPQEFNPEHFLDANQSFKKSP
AFMPFSAGRRLCLGESLARMELFLYLTAILQSFSLQPLGAPEDIDLTPLSSGLGNLPGPF
QLCLRPR
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgaccttacctgtccaggtacaccagatgcaaggaggaggagacaggacacttgagaaa
cggatcctagaaggagggcagcttctgctggcggagctgcgaaaaccctcaggcgagccc
tttgaccccacgtttgtgctgagtcgctcagtgtccaacattatctgttccgtgctcttc
ggcagccgcttcgactacgatgatgagcgtctgctcaccattatccgccttatcaatgac
aacttccaaatcatgagcagcccctggggcgagttgtacaacatcttcccgagcctcctg
aactgggtgcccgggccgcaccaacgcatcttccagaacttcaagtgcctgagagacctc
atcgcccacagcgtccacgaccaccaggcctcactagaccccagatctccccgggacttc
atagactgcttcctcaccaagatggcagagaagaaggaggacccgctgagccacttccac
atggataccctgctgatgaccacacataacctgctctttggcggcaccgagacggtgggc
accacgctgcgccacgccttcctggcactcatgaagtacccgaaagttcaagcccgcgtg
caggaggagatcgacctcgtggtgggacgcgcgcggctgccggcgctgaaggaccgcgcg
gccatgccttacacagacgcggtgatccacgaggtgcagcgctttgcagacatcatcccc
atgaacttgccgcaccgcgtcactagggacacggcctttcgcggcttcctgatacccaag
ggcaccgatgtcatcaccctccttaacaccgtccactacgaccccagccagttcctgacg
ccccaggagttcaaccccgagcattttttggatgccaatcagtccttcaagaagagccca
gccttcatgcccttctcagctgggcgccgtctgtgcctgggagagtcgctggcgcgcatg
gagctctttctgtacctcaccgccatcctgcagagcttttcgctgcagccgctgggtgcg
cccgaggacatcgacctgaccccgctcagctcaggtctcggcaatttgccggggcctttc
cagctgtgcctgcgcccgcgctaa

DBGET integrated database retrieval system