KEGG   Pan troglodytes (chimpanzee): 739158Help
Entry
739158            CDS       T01005                                 

Gene name
PTPN7
Definition
(RefSeq) protein tyrosine phosphatase, non-receptor type 7
  KO
K18019  
tyrosine-protein phosphatase non-receptor type 7 [EC:3.1.3.48]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    739158 (PTPN7)
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     739158 (PTPN7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 445 aa AA seqDB search
MLQGKRRRAASMNRLGCWPARSLPRSGRGSGQRSLGLGGHPSGPRHPGTPAAKRTWESPG
VRARDCPLSTSWLSEPPLGPAPHPSMVQAHGGRSRAQPLTLSLGAAMTQPPPAKTPAKKH
VRLQERRGSNVALMLDVRSLGAVEPICSVNTPREVTLHFLRTAGHPLTRWALQRQPPSPK
QLEEEFLKIPSNFVSPEDLDIPGHASKDRYKTILPNPQSRVCLGRAQSQEDGDYINANYI
RGYDGKEKVYIATQGPMPNTVSDFWEMVWQEEVSLIVMLTQLREGKEKCVHYWPTEEETY
GPFQIRIQDMKECPEYTVRQLTIQYQEERRSVKHILFSAWPDHQTPESAGPLLRLVAEVE
ESPETAAHPGPIVVHCSAGIGRTGCFIATRIGCQQLKARGEVDILGIVCQLRLDRGGMIQ
TAEQYQFLHHTLALYAGQLPEEPSP
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgttacaaggtaaaaggaggcgtgcagcgagcatgaaccggctgggctgctggcccgca
aggagcctgccaaggtcaggcaggggcagtgggcagaggagtcttggacttgggggccac
ccttcaggtcccaggcatccaggcaccccagcagcgaagaggacatgggagtcccctggt
gtgagggccagagactgtccactgtctacctcatggctgagtgagcctcccctgggccca
gcaccccaccccagcatggtccaagcccatggggggcgctccagagcacagccgttgacc
ttgtctttgggggcagccatgacccagcctccgcctgccaaaacgccagccaagaagcat
gtgcgactgcaggagaggcggggctccaatgtggctctgatgctggacgttcggtccctg
ggggccgtagaacccatctgctccgtgaacacaccccgggaggtcaccctacactttctg
cgcactgctggacacccccttacccgctgggcccttcagcgccagccacccagccccaag
caactggaagaagaattcttgaagatcccttcaaactttgtcagccccgaagacctggac
atccctggccacgcctccaaggaccgatacaagaccatcttgccaaatccccagagccgt
gtctgtctaggccgggcacagagccaggaggacggagattacatcaatgccaactacatc
cgaggctatgacgggaaggagaaggtctacattgccacccagggccccatgcccaacact
gtgtcggacttctgggagatggtgtggcaagaggaagtgtccctcattgtcatgctcact
cagctccgagagggcaaggagaaatgtgtccactactggcccacagaagaggaaacctat
ggacccttccagatccgcatccaggacatgaaagagtgcccagaatacactgtgcggcag
ctcaccatccagtaccaggaagagcgccggtcagtaaagcacatcctcttttcggcctgg
ccagaccaccagacaccagaatcagctgggcccctgctgcgcctagtggcagaggtggag
gagagcccggagacagccgcccaccccgggcctatcgtagtccactgcagtgcagggatt
ggccggacgggctgcttcattgccacgcgaattggctgtcaacagctgaaagcccgagga
gaagtggacattctgggtattgtgtgccaactgcggctagacagaggggggatgatccag
acggcagagcagtaccagttcctgcaccacactttggccctgtatgcaggccagctgccc
gaggaacccagcccctga

DBGET integrated database retrieval system