KEGG   Pan troglodytes (chimpanzee): 739351Help
Entry
739351            CDS       T01005                                 

Gene name
CCNH
Definition
cyclin H
Orthology
K06634  
cyclin H
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Basal transcription factors
Nucleotide excision repair
Cell cycle
Module
Holo-TFIIH complex
Class
Genetic Information Processing; Transcription; Basal transcription factors [PATH:ptr03022]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:ptr03420]
Cellular Processes; Cell growth and death; Cell cycle [PATH:ptr04110]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
5
AA seq 323 aa AA seqDB search
MYHNSSQKRHWTFSSEEQLARLRADANRKFRCKAVANGKVLPNDPVFLEPHEEMTLCKYY
EKRLLEFCSVFKPAMPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNV
SSPQFVGNLRESPLGQEKALEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDLKTRYPI
LENPEILRKTADDFLNRIALTDAYLLYTPSQIALTAILSSASRAGITMESYLSESLMLKE
NRTCLSQLLDIMKSMRNLVKKYEPPRSEEVAVLKQKLERCHSAELALNVITKKRKGYEDD
DYVSKKSKHEEEEWTDDDLVESL
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgtaccacaacagtagtcagaagcggcactggactttctccagcgaggagcagctggca
agactgcgggccgacgccaaccgcaaattcagatgcaaagccgtggccaacgggaaggtt
cttccgaatgatccagtctttcttgagcctcatgaagaaatgacactctgcaaatactat
gagaaaaggttattggaattctgttcggtgtttaagccagcaatgccaaggtctgttgtg
ggtacggcttgtatgtatttcaaacgtttttatcttaataactcagtaatggaatatcac
cccaggataataatgctcacttgtgcatttttggcctgcaaagtagatgaattcaatgta
tctagtcctcagtttgttggaaaccttcgggagagtcctcttggacaggagaaggcactt
gaacagatactggaatatgaactacttcttatacagcaacttaatttccaccttattgtc
cacaatccttacagaccatttgagggcttcctcatcgacttaaagacccgctatcccata
ttggagaatccagagattttgaggaaaacagctgatgactttcttaatagaattgcattg
acggatgcttaccttttatacacaccttcccaaattgccctgactgccattttatctagt
gcctccagggctggaattactatggaaagttatttatcagagagtctgatgctgaaagag
aacagaacttgcctgtcacagttactagatataatgaaaagcatgagaaacttagtaaaa
aagtatgaaccacccagatctgaagaagttgctgttctgaaacagaagttggagcgatgt
cattctgctgagcttgcacttaacgtaatcacgaagaagaggaaaggctatgaagatgat
gattacgtctcaaagaaatccaaacatgaggaggaagaatggactgatgacgacctggta
gaatctctctaa

DBGET integrated database retrieval system