KEGG   Pan troglodytes (chimpanzee): 739351Help
Entry
739351            CDS       T01005                                 

Gene name
CCNH
Definition
(RefSeq) cyclin-H
  KO
K06634  cyclin H
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr03022  Basal transcription factors
ptr03420  Nucleotide excision repair
ptr04110  Cell cycle
Module
ptr_M00290  Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    739351 (CCNH)
  Replication and repair
   03420 Nucleotide excision repair
    739351 (CCNH)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    739351 (CCNH)
Transcription machinery [BR:ptr03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     739351 (CCNH)
DNA repair and recombination proteins [BR:ptr03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     739351 (CCNH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cyclin_C_2 Cyclin_N Cyclin_C 5_3_exonuc_N
Motif
Other DBs
NCBI-GeneID: 739351
NCBI-ProteinID: NP_001075882
Ensembl: ENSPTRG00000017063
UniProt: H2QR75 G2HHF7
Position
5
AA seq 323 aa AA seqDB search
MYHNSSQKRHWTFSSEEQLARLRADANRKFRCKAVANGKVLPNDPVFLEPHEEMTLCKYY
EKRLLEFCSVFKPAMPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNV
SSPQFVGNLRESPLGQEKALEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDLKTRYPI
LENPEILRKTADDFLNRIALTDAYLLYTPSQIALTAILSSASRAGITMESYLSESLMLKE
NRTCLSQLLDIMKSMRNLVKKYEPPRSEEVAVLKQKLERCHSAELALNVITKKRKGYEDD
DYVSKKSKHEEEEWTDDDLVESL
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgtaccacaacagtagtcagaagcggcactggactttctccagcgaggagcagctggca
agactgcgggccgacgccaaccgcaaattcagatgcaaagccgtggccaacgggaaggtt
cttccgaatgatccagtctttcttgagcctcatgaagaaatgacactctgcaaatactat
gagaaaaggttattggaattctgttcggtgtttaagccagcaatgccaaggtctgttgtg
ggtacggcttgtatgtatttcaaacgtttttatcttaataactcagtaatggaatatcac
cccaggataataatgctcacttgtgcatttttggcctgcaaagtagatgaattcaatgta
tctagtcctcagtttgttggaaaccttcgggagagtcctcttggacaggagaaggcactt
gaacagatactggaatatgaactacttcttatacagcaacttaatttccaccttattgtc
cacaatccttacagaccatttgagggcttcctcatcgacttaaagacccgctatcccata
ttggagaatccagagattttgaggaaaacagctgatgactttcttaatagaattgcattg
acggatgcttaccttttatacacaccttcccaaattgccctgactgccattttatctagt
gcctccagggctggaattactatggaaagttatttatcagagagtctgatgctgaaagag
aacagaacttgcctgtcacagttactagatataatgaaaagcatgagaaacttagtaaaa
aagtatgaaccacccagatctgaagaagttgctgttctgaaacagaagttggagcgatgt
cattctgctgagcttgcacttaacgtaatcacgaagaagaggaaaggctatgaagatgat
gattacgtctcaaagaaatccaaacatgaggaggaagaatggactgatgacgacctggta
gaatctctctaa

DBGET integrated database retrieval system