KEGG   Pan troglodytes (chimpanzee): 739649Help
Entry
739649            CDS       T01005                                 

Definition
cytochrome P450 2S1-like
Orthology
K07420  
cytochrome P450, family 2, subfamily S, polypeptide 1 [EC:1.14.14.1]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Class
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:ptr00830]
Metabolism; Xenobiotics biodegradation and metabolism; Metabolism of xenobiotics by cytochrome P450 [PATH:ptr00980]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
19
AA seq 403 aa AA seqDB search
MEATGTWALLLALALLLLLTLALSGTRARGHLPPGPTPLPLLGNLLQLRPGALYSGLMRL
SKKYGPVFTIYLGPWRPVVVLVGQEAVREALGGQAEEFSGRGTVAMLEGTFDGHGVFFSN
GERWRQLRKFTMLALRDLGMGKREGEELIQAEARCLVETFQGTEGCVLSAPLPGFFQEEQ
NPGTEFTNKNMLMTVIYLLFAGTMTVSATVGYTLLLLMKYPHVQKRVREELNRELGAGQA
PSLGDRTRLPYTDAVLHEAQRLLALVPMGIPRTLMRTTRFRGYTLPQGTEVFPLLGSILH
DPNIFKHPEEFNPDRFLDADGRFRKHEAFLPFSLGKRVCLGEGLAKAELFLFFTTILQAF
SLESPCPPDTLSLKPTVSGLFNIPPAFQLQVRPTDLHSTTQTR
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atggaggcgaccggcacctgggcgctgctgctggcgctggcgctgctcctgctgctgacg
ctggcgctgtccgggaccagggcccgaggccacctgccccccgggcccacgccgctacca
ctgctgggaaacctcctgcagctacggcccggggcgctgtattcagggctcatgcggctg
agtaagaagtacggaccggtgttcaccatctacctgggaccctggcggcctgtggtggtc
ctggttgggcaggaggctgtgcgggaggccctgggaggtcaggctgaggagttcagcggc
cggggaaccgtagcgatgctggaagggacttttgatggccatggggttttcttctccaac
ggggagcggtggaggcagctgaggaagtttaccatgcttgctctgcgggacctgggcatg
gggaagcgagaaggcgaggagctgatccaggcggaggcccggtgtctggtggagacattc
caggggacagaaggctgtgttctctcagcccctctgcctggtttctttcaggaggaacaa
aacccaggcacagaattcaccaacaagaacatgctgatgacagtcatttatttgctgttt
gctgggacgatgacggtcagcgccacggtcggctataccctcctgctcctgatgaaatac
cctcatgtccaaaagcgggtacgtgaggagctgaatcgggagctgggggctggccaggca
ccaagcctaggggaccgtacccgcctcccttacaccgacgcggttctgcatgaggcgcag
cggctgctggcgctggtgcccatgggaataccccgcaccctcatgcggaccacccgcttc
cgagggtacaccctgccccagggcacggaggtcttccccctccttggctccatcctgcat
gaccccaacatcttcaagcacccagaagagttcaacccagaccgtttcctggatgcagat
ggacggttcaggaagcatgaggcgttcctgcccttctccttagggaagcgtgtctgcctt
ggagagggcctggcaaaagcggagctcttcctcttcttcaccaccatcctacaagccttc
tccctggagagcccgtgcccgccggacaccctgagcctcaagcccaccgtcagtggcctt
ttcaacatccccccagccttccagctgcaagtccgtcccactgaccttcactccaccacg
cagaccagatga

DBGET integrated database retrieval system