KEGG   Pan troglodytes (chimpanzee): 739649Help
Entry
739649            CDS       T01005                                 

Definition
cytochrome P450 2S1
Orthology
K07420  
cytochrome P450, family 2, subfamily S, polypeptide 1 [EC:1.14.14.1]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    739649
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    739649
Enzymes [BR:ptr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     739649
Cytochrome P450 [BR:ptr00199]
 Cytochrome P450, animal type
  CYP2 family
   739649
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
19
AA seq 504 aa AA seqDB search
MEATGTWALLLALALLLLLTLALSGTRARGHLPPGPTPLPLLGNLLQLRPGALYSGLMRL
SKKYGPVFTIYLGPWRPVVVLVGQEAVREALGGQAEEFSGRGTVAMLEGTFDGHGVFFSN
GERWRQLRKFTMLALRDLGMGKREGEELIQAEARCLVETFQGTEGRPFDPSLLLAQATSN
VVCSLLFGLRFSYEDKEFQAVVRAAGGTLLGVSSQGGQTYEMFSWFLRPLPGPHKQLLHH
VSTLAAFTVRQVQQHQGNLDALGPARDLVDAFLLKMAQEEQNPGTEFTNKNMLMTVIYLL
FAGTMTVSATVGYTLLLLMKYPHVQKRVREELNRELGAGQAPSLGDRTRLPYTDAVLHEA
QRLLALVPMGIPRTLMRTTRFRGYTLPQGTEVFPLLGSILHDPNIFKHPEEFNPDRFLDA
DGRFRKHEAFLPFSLGKRVCLGEGLAKAELFLFFTTILQAFSLESPCPPDTLSLKPTVSG
LFNIPPAFQLQVRPTDLHSTTQTR
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atggaggcgaccggcacctgggcgctgctgctggcgctggcgctgctcctgctgctgacg
ctggcgctgtccgggaccagggcccgaggccacctgccccccgggcccacgccgctacca
ctgctgggaaacctcctgcagctacggcccggggcgctgtattcagggctcatgcggctg
agtaagaagtacggaccggtgttcaccatctacctgggaccctggcggcctgtggtggtc
ctggttgggcaggaggctgtgcgggaggccctgggaggtcaggctgaggagttcagcggc
cggggaaccgtagcgatgctggaagggacttttgatggccatggggttttcttctccaac
ggggagcggtggaggcagctgaggaagtttaccatgcttgctctgcgggacctgggcatg
gggaagcgagaaggcgaggagctgatccaggcggaggcccggtgtctggtggagacattc
caggggacagaaggacgcccattcgatccctccctgctgctggcccaggccacctccaac
gtagtctgctccctcctctttggcctccgcttctcctatgaggataaggagttccaggcc
gtggtccgggcagctggtggtaccctgctgggagtcagctcccaggggggtcagacctac
gagatgttctcctggttcctgcggcccctgccaggcccccacaagcagctcctccaccac
gtcagcaccttggctgccttcacagtccggcaggtgcagcagcaccaggggaacctggat
gctttgggccccgcacgtgaccttgtcgatgccttcctgctgaagatggcacaggaggaa
caaaacccaggcacagaattcaccaacaagaacatgctgatgacagtcatttatttgctg
tttgctgggacgatgacggtcagcgccacggtcggctataccctcctgctcctgatgaaa
taccctcatgtccaaaagcgggtacgtgaggagctgaatcgggagctgggggctggccag
gcaccaagcctaggggaccgtacccgcctcccttacaccgacgcggttctgcatgaggcg
cagcggctgctggcgctggtgcccatgggaataccccgcaccctcatgcggaccacccgc
ttccgagggtacaccctgccccagggcacggaggtcttccccctccttggctccatcctg
catgaccccaacatcttcaagcacccagaagagttcaacccagaccgtttcctggatgca
gatggacggttcaggaagcatgaggcgttcctgcccttctccttagggaagcgtgtctgc
cttggagagggcctggcaaaagcggagctcttcctcttcttcaccaccatcctacaagcc
ttctccctggagagcccgtgcccgccggacaccctgagcctcaagcccaccgtcagtggc
cttttcaacatccccccagccttccagctgcaagtccgtcccactgaccttcactccacc
acgcagaccagatga

DBGET integrated database retrieval system