KEGG   Pan troglodytes (chimpanzee): 739942Help
Entry
739942            CDS       T01005                                 

Gene name
UGT1A6, UGT1A5
Definition
UDP glucuronosyltransferase 1 family, polypeptide A6
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Chemical carcinogenesis
Module
Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    739942 (UGT1A6)
   00053 Ascorbate and aldarate metabolism
    739942 (UGT1A6)
   00500 Starch and sucrose metabolism
    739942 (UGT1A6)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    739942 (UGT1A6)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    739942 (UGT1A6)
   00860 Porphyrin and chlorophyll metabolism
    739942 (UGT1A6)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    739942 (UGT1A6)
   00982 Drug metabolism - cytochrome P450
    739942 (UGT1A6)
   00983 Drug metabolism - other enzymes
    739942 (UGT1A6)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    739942 (UGT1A6)
Enzymes [BR:ptr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     739942 (UGT1A6)
Glycosyltransferases [BR:ptr01003]
 Others
  Hydrophobic molecule
   739942 (UGT1A6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
2B
AA seq 265 aa AA seqDB search
MPNMVFIGGINCKKRKDLSQEFEAYINASGEHGIVVFSLGSMVSEIPEKKAMAIADALGK
IPQTVLWRYTGTRPSNLANNTILVKWLPQNDLLGHPMTRAFITHAGSHGVYESICNGVPM
VMMPLFGDQMDNAKRMETKGAGVTLNVLEMTSEDLENALKAVINDKSYKENIMRLSSLHK
DRPVEPLDLAVFWVEFVMRHKGAPHLRPAAHDLTWYQYHSLDVIGFLLAVVLTVAFITFK
CCAYGYRKCFGKKGRVKKAHKSKTH
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgcccaacatggtcttcattggaggtatcaactgtaagaagaggaaagacttgtctcag
gaatttgaagcctacattaatgcttctggagaacatggaattgtggttttctctttggga
tcaatggtctcagaaattccagagaagaaagctatggcaattgctgatgctttgggcaaa
atccctcagacagtcctgtggcggtacactggaacccgaccatcgaatcttgcgaacaac
acgatacttgttaagtggctaccccaaaacgatctgcttggtcacccgatgacccgtgcc
tttatcacccatgctggttcccatggtgtttatgaaagcatatgcaatggcgttcccatg
gtgatgatgcccttgtttggtgatcagatggacaatgcaaagcgcatggagactaaggga
gctggagtgaccctgaatgttctggaaatgacttctgaagatttagaaaatgctctaaaa
gcagtcatcaatgacaaaagctacaaggagaacatcatgcgcctctccagccttcacaag
gaccgcccggtggagccgctggacctggccgtgttctgggtggagtttgtgatgaggcac
aagggcgcgccacacctgcgccccgcagctcacgacctcacctggtaccagtaccattcc
ttggacgtgatcggtttcctcttggccgtcgtgctgacagtggccttcatcacctttaaa
tgttgtgcttatggctaccggaaatgcttcgggaaaaaagggcgagttaagaaagcccac
aaatccaagacccattga

DBGET integrated database retrieval system