KEGG   Pan troglodytes (chimpanzee): 739978Help
Entry
739978            CDS       T01005                                 

Gene name
TMX3, TXNDC10
Definition
thioredoxin-related transmembrane protein 3
Orthology
K09585  
thioredoxin domain-containing protein 10 [EC:5.3.4.1]
Organism
ptr  Pan troglodytes (chimpanzee)
Brite
Enzymes [BR:ptr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     739978 (TMX3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
18
AA seq 454 aa AA seqDB search
MAAWKSWTALRLCATVVVLDMVVCKGFVEDLDESFKENRNDDIWLVDFYAPWCGHCKKLE
PIWNEVGLEMKSIGSPVKVGKMDATSYSSIASEFGVRGYPTIKLLKGDLAYNYRGPRTKD
DIIEFAHRVSGALIRPLPSQQMFEHMQKRHRVFFVYVGGESPLKEKYIDAASELIVYTYF
FSASEEVVPEYVTLKEMPAVLVFKDETYFVYDEYEDGDLSSWINRERFQNYLAMDGFLLY
ELGDTGKLVALAVIDEKNTSVEHTRLKSIIQEVARDYRDLFHRDFQFGHMDGNDYINTLL
MDELTVPTVVVLNTSNQQYFLLDRQIKNVEDMVQFINNILDGTVEAQGGDSILQRLKRIV
FDAKSTIVSIFKSSPLMGCFLFGLPLGVISIMCYGIYTADTDGGYIEERYEVSKSENENQ
EQVEESKEQQEPSSGGSVVPTAQEPKDVLEKKKD
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atggcagcgtggaagagttggacggccctgcggctctgcgccacagttgttgtacttgat
atggtcgtctgtaaaggatttgtagaagatttagatgaatcgtttaaagaaaatcgaaat
gatgacatttggcttgtagatttttatgcaccatggtgtggccattgtaaaaagctggaa
ccgatttggaatgaagttggtcttgagatgaaaagcattggttctccagttaaggttgga
aagatggatgctacttcctattctagcattgcttcagagtttggagttcgaggttatcca
acaattaagctattaaaaggggacttggcatataattatagaggaccacgaacaaaagat
gatattattgagtttgctcacagagtatctggggctctaattcggccacttccaagtcaa
caaatgtttgaacatatgcagaagagacaccgtgtatttttcgtttatgtaggtggagaa
tcacctttgaaagagaaatacatagatgctgcttcagaattgattgtatatacatacttc
ttttctgcctcagaagaagtggttcctgagtatgtgacactaaaagagatgccggctgtg
cttgttttcaaagatgaaacttactttgtttatgatgagtatgaagatggtgatctgtcg
tcatggatcaacagggaaaggtttcagaattaccttgctatggatggcttcctcttgtat
gaacttggagacacaggaaagcttgtggctcttgcagttattgatgagaaaaatacatca
gttgaacataccagattgaagtcaattattcaggaagttgcaagagattacagagacctc
ttccatagggattttcagtttggccacatggatggaaatgactacataaataccttgctg
atggatgaattgacagtcccaactgtagttgtactgaatacttcaaaccagcaatatttc
ttgctagatagacagattaagaatgttgaagacatggtccagtttattaataacattttg
gatggcacagtagaagcccaaggaggtgatagcattttgcagagattgaaaaggatagta
tttgatgccaaatctactattgtgtctatattcaagagctcaccactgatgggctgcttt
ctctttggcctgccactgggtgtcatcagtatcatgtgctatggaatctacacagccgac
acagatggaggttatatagaagaacgatatgaagtgtctaaaagtgaaaatgaaaaccaa
gaacaggtagaagagagcaaagaacagcaggagcccagcagtggaggatctgtagtgcct
acagcgcaggagcccaaggatgtattagaaaagaagaaagattga

DBGET integrated database retrieval system