KEGG   Pan troglodytes (chimpanzee): 740001Help
Entry
740001            CDS       T01005                                 

Definition
NADH-cytochrome b5 reductase 1-like
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Amino sugar and nucleotide sugar metabolism
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ptr00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 424 aa AA seqDB search
MTWCTHFPQVSVQAASKIQRNMYWGLRNIFSQWRGKGKLSISWITHRVHQIQLKTGGSNV
PAALMTVDVGVPISHIRARDSARLPLCPWHASALELGIATXGTVTTQAPGSYPAWRSRCL
LYPQSPVLLASLGVGLVTLLGLAVGSYLVRRSRRPQVTLLDPNEKYLLRLLDKTTVSHNT
KRFRFALPTAHHTLGLPVGKHIYLSTRIDGSLVIRPYTPVTSDEDQGYVDLVIKVYLKGV
HPKFPEGGKMSQYLDSLKVGDVVEFRGPSGLLTYTGKGHFNIQPNKKSPPEPRVAKKLGM
IAGGTGITPMLQLIRAILKVPEDPTQCFLLFANQTEKDIILREDLEELQARYPNRFKLWF
TLDHPPKDWAYSKGFVTADMIREHLPAPGDDVLVLLCGPPPMVQLACHPNLDKLGYSQKM
RFTY
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgacctggtgcactcacttccctcaagtcagtgtgcaggctgcttcaaaaattcagagg
aacatgtactggggtcttaggaacattttcagccagtggagaggaaaaggaaaactaagt
atctcttggatcactcacagagttcaccaaatacaactgaaaactgggggctccaatgtc
cctgctgccctgatgaccgtggatgtgggggtcccgatctcgcacatccgggctcgggac
tccgccaggttacccctctgcccttggcatgcctccgcgctggagctcgggatcgccacc
cntgggacggtcaccacccaagccccgggctcttacccagcctggcggtcacgctgcctc
ctctacccacagagccccgtcctgctggcctccctgggggtggggctggtcactctgctc
ggcctggctgtgggctcctacttggttcggaggtcccgccggcctcaggtcactctcctg
gaccccaatgaaaagtacctgctacgactgctagacaagacgactgtgagccacaacacc
aagaggttccgctttgccctgcccaccgcccaccacactctggggctgcctgtgggcaaa
catatctacctctccacccgaattgatggcagcctggtcatcaggccatacactcctgtc
accagtgatgaggatcaaggctacgtggatcttgtcatcaaggtctacctgaagggtgtg
caccccaaatttcctgagggagggaagatgtctcagtacctggatagcctgaaggttggg
gatgtggtggagtttcgggggccaagcgggttgctcacttacactggaaaagggcatttt
aatattcagcccaacaagaaatctccaccagaaccccgagtggcgaagaaactgggaatg
attgccggcgggacaggaatcaccccaatgctacagctgatccgggccatcctaaaagtc
ccagaagatccaacccagtgctttctgctttttgccaaccagacagaaaaggatatcatc
ttgcgggaggacttagaggaactgcaggcccgctatcccaatcgctttaagctctggttc
actctggatcatcccccaaaagattgggcctacagcaagggctttgtgactgccgacatg
atccgggaacacctgcctgctccaggggatgatgtgctggtactgctttgtgggccaccc
ccaatggtgcagctggcctgccatcccaacttggacaaactgggctactcacaaaagatg
cgattcacctactga

DBGET integrated database retrieval system