KEGG   Pan troglodytes (chimpanzee): 740432Help
Entry
740432            CDS       T01005                                 

Gene name
GUK1
Definition
guanylate kinase 1
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    740432 (GUK1)
Enzymes [BR:ptr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     740432 (GUK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 241 aa AA seqDB search
MLRRPLAGLAAAALGRAPPDGMSGPRPVVLSGPSGAGKSTLLKRLLQEHSGIFGFSVSHT
TRNPRPGEENGKDYYFVTREVMQRDIAAGDFIEHAEFSGNLYGTSKVAVQAVQAMNRICV
LDVDLQGVRNIKATDLQPIYISVQPPSLHVLEQRLRQRNTETEESLVKRLAAAQADMESR
NQESSKDRRLRLAVCSWHPGPIQDQGSSTEPPPWQAIRQLCALCQHVEWRGCCPCGWNIL
G
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgctgcggcgcccgctggccgggctggctgcggccgccctgggccgggccccaccggac
ggcatgtcgggccccaggcctgtggtgctgagcgggccttcgggagctgggaagagcacc
ctgctgaagaggctgctccaggagcacagcggcatctttggcttcagcgtgtcccatacc
acgaggaacccgaggcccggcgaggagaacggcaaagattactactttgtaaccagggag
gtgatgcagcgtgacatagcagccggcgacttcatcgagcatgccgagttctcggggaac
ctgtatggcacgagcaaggtggcggtgcaggctgtgcaggccatgaaccgcatctgtgtg
ctggacgtggacctgcagggtgtgcggaacatcaaggccaccgatctgcagcccatctac
atctctgtgcagccaccttcactgcatgtgctggagcagcggctgcggcagcgcaacact
gaaacggaggagagcctggtgaagcggctggctgctgcccaggccgacatggagagcaga
aatcaagaaagctcaaaggaccggcgcctgaggcttgctgtctgttcttggcaccccggg
cccatacaggaccagggcagcagcactgagccacccccttggcaggcgatacggcagctc
tgcgccctttgccagcatgtggagtggaggggatgctgcccctgtggttggaacatcctg
gggtga

DBGET integrated database retrieval system