KEGG   Pan troglodytes (chimpanzee): 740516Help
Entry
740516            CDS       T01005                                 

Gene name
MMP8
Definition
matrix metallopeptidase 8 (neutrophil collagenase)
Orthology
K01402  
matrix metalloproteinase-8 (neutrophil collagenase) [EC:3.4.24.34]
Organism
ptr  Pan troglodytes (chimpanzee)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
11
AA seq 467 aa AA seqDB search
MFSLKMLPFLLLLHVQISKAFPVSSKEKNTKIVQDYLEKFYQLPSNQYQSTRKNGTNVIV
EKLKEMQRFFGLNVTGKPNEETLDMMKKPRCGVPDSGGFMLTPGNPKWEHTNLTYRIRNY
TPQLSEAEVERAIKDAFELWSVASPLIFTRISQGEADINIAFYQRDHGDNSPFDGPNGIL
AHAFQPGQGIGGDAHFDAEETWTDTSANYNLFLVAAHEFGHSLGLAHSSDPGALMYPNYA
FRETSNYSLPQDDIDGIQAIYGLSSNPIQPTGPSTPKPCDPSLTFDAITTLRGEILFFKD
RYFWRRHPQLQRVEMNFISLFWPSLPTGIQAAYEDFDRDLIFLFKGNQYWALSGYDILQG
YPKDIANYGFPSSVQAIDAAVFYRSKTYFFVNDQFWRYDNQRQFMEPGYPKSISGAFPGI
ESKVDAVFQQEHFFLFFSGPRYYAFDLIAQRVTRVARGNKWLNCRYG
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgttctccctgaagatgcttccatttctgctcttactccatgtgcagatttccaaggcc
tttcctgtatcttctaaagagaaaaatacaaaaattgttcaggactacctggaaaagttc
taccaattaccaagcaaccagtatcagtctacaaggaagaatggcactaatgtgatcgtt
gaaaagcttaaagaaatgcagcgattttttgggttgaatgtgacggggaagccaaatgag
gaaactctggacatgatgaaaaagcctcgctgtggagtgcctgacagtggtggttttatg
ttaaccccaggaaaccccaagtgggaacacactaacttgacctacaggattcgaaactat
accccacagctgtcagaggctgaggtagaaagagctatcaaggatgcctttgaactctgg
agtgttgcatcacctctcatcttcaccaggatctcacagggagaggcagatatcaacatc
gctttttaccaaagagatcacggtgacaattctccatttgatggacccaatggaatcctt
gctcatgcctttcagccaggccaaggtattggaggagatgctcattttgatgccgaagaa
acatggaccgacacctccgcaaattacaacttgtttcttgttgctgctcatgaatttggc
cattctctggggctcgctcactcctctgaccctggtgccttgatgtatcccaactatgct
ttcagggaaaccagcaactactcactccctcaagatgacatcgatggcattcaggccatc
tatggactttcaagcaaccctatccaacctactggaccaagtacacccaaaccctgtgac
cccagtttgacatttgatgctatcaccacactccgtggagaaatacttttctttaaagac
aggtacttctggagaaggcatcctcagctacaaagagtcgaaatgaattttatttctcta
ttctggccatcccttccaactggtatacaggctgcttatgaagattttgacagagacctc
attttcctatttaaaggcaaccaatactgggctctgagtggctatgatattctgcaaggt
tatcccaaggatatagcaaactatggcttccccagcagtgtccaagcaattgacgcagct
gttttctacagaagtaaaacatacttctttgtaaatgaccaattctggagatatgataac
caaagacaattcatggaaccaggttatcccaaaagcatatcaggtgcctttccaggaata
gagagtaaagttgatgcagttttccagcaagaacatttcttccttttcttcagtggacca
agatattacgcatttgaccttattgctcagagagttaccagagttgcaagaggcaataaa
tggcttaactgtagatatggctga

DBGET integrated database retrieval system