KEGG   Pan troglodytes (chimpanzee): 740580Help
Entry
740580            CDS       T01005                                 

Gene name
MGST1
Definition
microsomal glutathione S-transferase 1 (EC:2.5.1.18)
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Glutathione metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Chemical carcinogenesis
Class
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:ptr00480]
Metabolism; Xenobiotics biodegradation and metabolism; Metabolism of xenobiotics by cytochrome P450 [PATH:ptr00980]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - cytochrome P450 [PATH:ptr00982]
Human Diseases; Cancers; Chemical carcinogenesis [PATH:ptr05204]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
12
AA seq 155 aa AA seqDB search
MVDLTQVMDDEVFMAFASYATIILSKMMLMSTATAFYRLTRKVFANPEDCVAFGKGENAK
KYLRTDDRVERVRRAHLNDLENIIPFLGIGLLYSLSGPDPSTAILHFRLFVGARIYHTIA
YLTPLPQPNRAFSFFVGYGVTLSMAYRLLKSKLYL
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atggttgacctcacccaggtaatggatgatgaagtattcatggcttttgcgtcctatgca
acaattattctttcaaaaatgatgcttatgagtactgcaactgcattctatagattgaca
agaaaggtttttgccaatccagaagactgtgtagcatttggcaaaggagaaaatgccaag
aagtatcttcgaacagatgacagagtagaacgtgtacgcagagcccacctgaatgacctt
gaaaatattattccatttcttggaattggcctcctgtattccttgagtggtcccgacccc
tctacagccatcctgcacttcagactatttgtcggagcacggatctaccacaccattgca
tatttgacaccccttccccagccaaatagagctttcagtttttttgttggatatggagtt
actctttccatggcttacaggttgctgaaaagtaaattgtacctgtaa

DBGET integrated database retrieval system