KEGG   Pan troglodytes (chimpanzee): 740580Help
Entry
740580            CDS       T01005                                 

Gene name
MGST1
Definition
(RefSeq) microsomal glutathione S-transferase 1
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Glutathione metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Platinum drug resistance
Pathways in cancer
Chemical carcinogenesis
Hepatocellular carcinoma
Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    740580 (MGST1)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    740580 (MGST1)
   00982 Drug metabolism - cytochrome P450
    740580 (MGST1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    740580 (MGST1)
   05204 Chemical carcinogenesis
    740580 (MGST1)
   05225 Hepatocellular carcinoma
    740580 (MGST1)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    740580 (MGST1)
  Drug resistance
   01524 Platinum drug resistance
    740580 (MGST1)
Enzymes [BR:ptr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     740580 (MGST1)
Transporters [BR:ptr02000]
 Other Transporters
  Pores ion channels [TC:1]
   740580 (MGST1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
12
AA seq 155 aa AA seqDB search
MVDLTQVMDDEVFMAFASYATIILSKMMLMSTATAFYRLTRKVFANPEDCVAFGKGENAK
KYLRTDDRVERVRRAHLNDLENIIPFLGIGLLYSLSGPDPSTAILHFRLFVGARIYHTIA
YLTPLPQPNRAFSFFVGYGVTLSMAYRLLKSKLYL
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atggttgacctcacccaggtaatggatgatgaagtattcatggcttttgcgtcctatgca
acaattattctttcaaaaatgatgcttatgagtactgcaactgcattctatagattgaca
agaaaggtttttgccaatccagaagactgtgtagcatttggcaaaggagaaaatgccaag
aagtatcttcgaacagatgacagagtagaacgtgtacgcagagcccacctgaatgacctt
gaaaatattattccatttcttggaattggcctcctgtattccttgagtggtcccgacccc
tctacagccatcctgcacttcagactatttgtcggagcacggatctaccacaccattgca
tatttgacaccccttccccagccaaatagagctttcagtttttttgttggatatggagtt
actctttccatggcttacaggttgctgaaaagtaaattgtacctgtaa

DBGET integrated database retrieval system