KEGG   Pan troglodytes (chimpanzee): 740585Help
Entry
740585            CDS       T01005                                 

Gene name
ALPPL2, ALPI
Definition
alkaline phosphatase, placental-like 2
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    740585 (ALPPL2)
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     740585 (ALPPL2)
Exosome [BR:ptr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   740585 (ALPPL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
2B
AA seq 532 aa AA seqDB search
MQGPWVLLLLGLRLQLSLGIIPVEEENPDFWNRQAAEALGAAKKLQPAQTAAKNLIIFLG
DGMGVSTVTAARILKGQKKDKLGPETFLAMDRFPYVALSKTYSVDKHVPDSGATATAYLC
GVKGNFQTIGLSAAARFNQCNTTRGNEVISVMNRAKKAGKSVGVVTTTRVQHASPAGAYA
HTVNRNWYSDADVPASARQEGCQDIATQLISNMDIDVILGGGRKYMFPMGTPDPEYPDDY
SQGGTRLDGKNLVQEWLAKHQGARYVWNRTELMQASLDPSVTHLMGLFEPGDMKYEIHRD
STLDPSLMEMTEAALRLLSRNPRGFFLFVEGGRIDHGHHESRAYRALTETIMFDDAIERA
GQLTSEEDTLSLVTADHSHVFSFGGYPLRGSSIFGLAPGKARDRKAYTVLLYGNGPGYVL
KDGARPDVTESESGSPEYRQQSAVPLDGETHAGEDVAVFARGPQAHLVHGVQEQTFIAHV
MAFAACLEPYTACDLAPPAGTTDAAHPGPSVVPALLPLLAGTLLLLGTATAP
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgcaggggccctgggtgctgctcctgctgggcctgaggctacagctctccctgggcatc
atcccagttgaggaggagaacccggacttctggaaccgccaggcagctgaggccctgggt
gccgccaagaagctgcagcctgcacagacagccgccaagaacctcatcatcttcctgggt
gacgggatgggggtgtctacggtgacagctgccaggatcctaaaagggcagaagaaggac
aaactggggccagagaccttcctggccatggaccgcttcccatatgtggctctgtccaag
acatacagtgtagacaagcatgtgccagacagtggagccacagccacggcctacctgtgc
ggggtcaagggcaacttccagaccattggcttgagtgcagccgcccgctttaaccagtgc
aacacgacacgcggcaacgaggtcatctccgtgatgaatcgggccaagaaagcaggaaag
tcagtgggagtggtaaccaccacacgggtgcagcatgcctcgccagccggcgcctacgcc
cacacggtgaaccgcaactggtactcggacgccgacgtgcctgcctcggcccgccaggag
gggtgccaggacatcgccacgcagctcatctccaacatggacattgacgtgatcctaggt
ggaggccgaaagtacatgtttcccatggggaccccagaccctgagtacccagatgactac
agccaaggtgggaccaggctggacgggaagaatctggtgcaggaatggctggcaaagcat
cagggtgcccggtacgtgtggaaccgcactgagctcatgcaggcttccctggacccgtct
gtgacccatctcatgggtctctttgagcctggagacatgaaatacgagatccaccgagac
tccacgctggacccctccctgatggagatgacagaggctgccctgcgcctgctgagcagg
aacccccgcggcttcttcctcttcgtggagggtggtcgcatcgaccatggtcatcatgaa
agcagggcttaccgggcactgactgagacgatcatgttcgacgacgccattgagagggcg
ggccagctcaccagcgaggaggacacgctgagcctcgtcactgccgaccactcccacgtc
ttctccttcggaggctaccccctgcgagggagctccatcttcgggctggcccctggcaag
gcccgggacaggaaggcctacacggtcctcctatacggaaacggtccgggctatgtgctc
aaggacggcgcccggccggatgttaccgagagcgagagcgggagccccgagtatcggcag
cagtcagcagtgcccctggacggagagacccacgcaggcgaggacgtggcggtgttcgcg
cgcggcccgcaggcgcacctggttcacggcgtgcaggagcagaccttcatagcgcacgtc
atggccttcgccgcctgcctggagccctacacggcctgcgacctggcgccccccgccggc
accaccgacgccgcgcacccggggccgtccgtggtccccgcgttgcttcctctgctggca
gggaccttgctgctgctggggacggccactgctccctga

DBGET integrated database retrieval system