KEGG   Pan troglodytes (chimpanzee): 740956Help
Entry
740956            CDS       T01005                                 

Gene name
CYP2C19
Definition
(RefSeq) cytochrome P450 2C19 isoform X1
  KO
K17721  cytochrome P450 family 2 subfamily C polypeptide 19 [EC:1.14.14.51 1.14.14.52 1.14.14.53 1.14.14.-]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr00590  Arachidonic acid metabolism
ptr00591  Linoleic acid metabolism
ptr00982  Drug metabolism - cytochrome P450
ptr01100  Metabolic pathways
ptr04726  Serotonergic synapse
ptr05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    740956 (CYP2C19)
   00591 Linoleic acid metabolism
    740956 (CYP2C19)
  Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    740956 (CYP2C19)
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    740956 (CYP2C19)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    740956 (CYP2C19)
Enzymes [BR:ptr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.51  (S)-limonene 6-monooxygenase
     740956 (CYP2C19)
    1.14.14.52  (S)-limonene 7-monooxygenase
     740956 (CYP2C19)
    1.14.14.53  (R)-limonene 6-monooxygenase
     740956 (CYP2C19)
    1.14.14.-  
     740956 (CYP2C19)
Cytochrome P450 [BR:ptr00199]
 Cytochrome P450, animal type
  CYP2 family
   740956 (CYP2C19)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 740956
NCBI-ProteinID: XP_024202271
Ensembl: ENSPTRG00000002779
Position
10
AA seq 497 aa AA seqDB search
MDPFVVLVLCLSCLLLLSIWRQSSGRGKLPPGPTPLPVIGNILQIDIKDVSKSLTNLSKV
YGPVFTLYFGLERMVVLHGYEVVKEALIDLGEEFSGRGHFPLAERANRGFGIVFSNGKRW
KEIRRFSLMTLQNFGMGKRSIEDRVQEEARCLVEELRKTKASPCDPTFILGCAPCNVICS
IIFQKRFDYKDQQFLNLMEKLNENIRIVSTPWIQICNNFPTIIDYFPGTHNKLLKNLAFM
ERDILEKVKEHQESMDINNPRDFIDCFLIKMEKEKQNQQSEFTIENLVITAADLLGAGTE
TTSTTLRYALLLLLKHPEVTVLTRVLSAKVQEEIERVIGRNRSPCMQDRGHMPYTDAVVH
EVQRYIDLLPTSLPHAVTCDVKFRNYLIPKGTTILTSLTSVLHDKKEFPNPEMFDPRHFL
DEGGNFKKSNYFMPFSAGKRICVGEGLARMELFLFLTFILQNFNLKSLIDPKDLDTTPVV
NGLASVPPFYQLCFIPV
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atggatccttttgtggtccttgtgctctgtctctcatgtttgcttctcctttcaatctgg
agacagagctctgggagaggaaaactccctcctggccccactcctctcccagtgattgga
aatatcctacagatagatattaaggacgtcagcaaatccttaaccaatctctcaaaagtc
tatggccctgtgttcactctgtattttggcctggaacgcatggtggtgctgcatggatat
gaagtggtgaaggaagccctgattgatcttggagaggagttttctggaagaggccatttc
ccactggctgaaagagctaacagaggatttggaatcgttttcagcaatggaaagagatgg
aaggagatccggcgtttctccctcatgactctgcagaattttgggatggggaagaggagc
attgaggaccgtgttcaagaggaagcccgctgccttgtggaggagttgagaaaaaccaag
gcttcaccctgtgatcccactttcatcctgggctgtgctccctgcaatgtgatctgctcc
attattttccagaaacgttttgattataaagatcagcaatttcttaacttgatggaaaaa
ttgaatgaaaacatcaggattgtaagcaccccctggatccagatatgcaataattttccc
actatcattgattatttcccgggaacccataacaaattacttaaaaaccttgcttttatg
gaaagggatattttggagaaagtaaaagaacaccaagaatcgatggacatcaacaaccct
cgggactttattgattgcttcctgatcaaaatggagaaggaaaagcaaaaccaacagtct
gaattcactattgaaaacttggtaatcactgcagctgacttacttggagctgggacagag
acgacaagcacaaccctgagatatgctctccttctcttgctgaagcacccagaggtcaca
gttcttactcgtgtcttgtcagctaaagtccaggaagagattgaacgtgtgattggcaga
aaccggagcccctgcatgcaggacaggggccacatgccctacacagatgctgtggtacac
gaggtccagagatacattgacctcctccccaccagcctgccccatgcagtgacctgtgac
gttaaattcagaaactacctcattcccaagggcacaaccatattaacttccctgacttct
gtgctacatgacaagaaagaatttcccaacccagagatgtttgaccctcgtcactttctg
gatgaaggtggcaattttaagaaaagtaactacttcatgcctttctcagcaggaaaacgg
atttgtgtaggagagggcctggcccgcatggagctgtttttattcctgaccttcatttta
cagaactttaacctgaaatctctgattgacccaaaggaccttgacacaactcctgttgtc
aatggattggcttctgtcccgcccttctatcagctgtgcttcattcctgtctga

DBGET integrated database retrieval system