KEGG   Pan troglodytes (chimpanzee): 740956Help
Entry
740956            CDS       T01005                                 

Definition
(RefSeq) cytochrome P450 2C19
  KO
K17721  
cytochrome P450, family 2, subfamily C, polypeptide 19 [EC:1.14.13.48 1.14.13.49 1.14.13.80 1.14.13.-]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Arachidonic acid metabolism
Linoleic acid metabolism
Drug metabolism - cytochrome P450
Metabolic pathways
Serotonergic synapse
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    740956
   00591 Linoleic acid metabolism
    740956
  Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    740956
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    740956
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    740956
Enzymes [BR:ptr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.48  (S)-limonene 6-monooxygenase
     740956
    1.14.13.49  (S)-limonene 7-monooxygenase
     740956
    1.14.13.80  (R)-limonene 6-monooxygenase
     740956
    1.14.13.-  
     740956
Cytochrome P450 [BR:ptr00199]
 Cytochrome P450, animal type
  CYP2 family
   740956
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
10
AA seq 490 aa AA seqDB search
MDPFVVLVLCLSCLLLLSIWRQSSGRGKLPPGPTPLPVIGNILQIDIKDVSKSLTNLSKV
YGPVFTLYFGLERMVVLHGYEVVKEALIDLGEEFSGRGHFPLAERANRGFGIVFSNGKRW
KEIRRFSLMTLQNFGMGKRSIEDRVQEEARCLVEELRKTKASPCDPTFILGCAPCNVICS
IIFQKRFDYKDQQFLNLMEKLNENIRIVSTPWIQICNNFPTIIDYFPGTHNKLLKNLAFM
ERDILEKVKEHQESMDINNPRDFIDCFLIKMEKEKQNQQSEFTIENLVITAADLLGAGTE
TTSTTLRYALLLLLKHPEVTAKVQEEIERVIGRNRSPCLQDRGHMPYTDAVVHEVQRYID
LLPTSLPHAVTCDVKFRNYLIPKGTTILTSLTSVLHDKKEFPNPEMFDPRHFLDEGGNFK
KSNYFMPFSAGKRICVGEGLARMELFLFLTFILQNFNLKSLIDPKDLDTTPVVNGLASVP
PFYQLCFIPV
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggatccttttgtggtccttgtgctctgtctctcatgtttgcttctcctttcaatctgg
agacagagctctgggagaggaaaactccctcctggccccactcctctcccagtgattgga
aatatcctacagatagatattaaggacgtcagcaaatccttaaccaatctctcaaaagtc
tatggccctgtgttcactctgtattttggcctggaacgcatggtggtgctgcatggatat
gaagtggtgaaggaagccctgattgatcttggagaggagttttctggaagaggccatttc
ccactggctgaaagagctaacagaggatttggaatcgttttcagcaatggaaagagatgg
aaggagatccggcgtttctccctcatgactctgcagaattttgggatggggaagaggagc
attgaggaccgtgttcaagaggaagcccgctgccttgtggaggagttgagaaaaaccaag
gcttcaccctgtgatcccactttcatcctgggctgtgctccctgcaatgtgatctgctcc
attattttccagaaacgttttgattataaagatcagcaatttcttaacttgatggaaaaa
ttgaatgaaaacatcaggattgtaagcaccccctggatccagatatgcaataattttccc
actatcattgattatttcccgggaacccataacaaattacttaaaaaccttgcttttatg
gaaagggatattttggagaaagtaaaagaacaccaagaatcgatggacatcaacaaccct
cgggactttattgattgcttcctgatcaaaatggagaaggaaaagcaaaaccaacagtct
gaattcactattgaaaacttggtaatcactgcagctgacttacttggagctgggacagag
acgacaagcacaaccctgagatatgctctccttctcttgctgaagcacccagaggtcaca
gctaaagtccaggaagagattgaacgtgtgattggcagaaaccggagcccctgcttgcag
gacaggggccacatgccctacacagatgctgtggtacacgaggtccagagatacattgac
ctcctccccaccagcctgccccatgcagtgacctgtgacgttaaattcagaaactacctc
attcccaagggcacaaccatattaacttccctgacttctgtgctacatgacaagaaagaa
tttcccaacccagagatgtttgaccctcgtcactttctggatgaaggtggcaattttaag
aaaagtaactacttcatgcctttctcagcaggaaaacggatttgtgtaggagagggcctg
gcccgcatggagctgtttttattcctgaccttcattttacagaactttaacctgaaatct
ctgattgacccaaaggaccttgacacaactcctgttgtcaatggattggcttctgtcccg
cccttctatcagctgtgcttcattcctgtctga

DBGET integrated database retrieval system