KEGG   Pan troglodytes (chimpanzee): 741158Help
Entry
741158            CDS       T01005                                 

Definition
cytochrome c-like
Orthology
K08738  
cytochrome c
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Sulfur metabolism
Metabolic pathways
p53 signaling pathway
Apoptosis
Non-alcoholic fatty liver disease (NAFLD)
Alzheimer's disease
Parkinson's disease
Amyotrophic lateral sclerosis (ALS)
Huntington's disease
Legionellosis
Toxoplasmosis
Tuberculosis
Hepatitis B
Influenza A
Herpes simplex infection
Pathways in cancer
Colorectal cancer
Small cell lung cancer
Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    741158
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    741158
   04115 p53 signaling pathway
    741158
 Human Diseases
  Cancers
   05200 Pathways in cancer
    741158
   05210 Colorectal cancer
    741158
   05222 Small cell lung cancer
    741158
  Neurodegenerative diseases
   05010 Alzheimer's disease
    741158
   05012 Parkinson's disease
    741158
   05014 Amyotrophic lateral sclerosis (ALS)
    741158
   05016 Huntington's disease
    741158
  Cardiovascular diseases
   05416 Viral myocarditis
    741158
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    741158
  Infectious diseases
   05134 Legionellosis
    741158
   05152 Tuberculosis
    741158
   05164 Influenza A
    741158
   05161 Hepatitis B
    741158
   05168 Herpes simplex infection
    741158
   05145 Toxoplasmosis
    741158
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
9
AA seq 102 aa AA seqDB search
MGDVEKGKKIFVQKCAQCHTVEKGGKHKTEHNLHGLFGQKTGQAVGFSYTDANKNKGITW
GEDTLMEYLENPKKYIPGTKMIFAGIKKKAERKMIAYLKKSY
NT seq 309 nt NT seq  +upstreamnt  +downstreamnt
atgggtgatgttgagaagggcaagaagatttttgttcagaagtgtgcccagtgccacacc
gtggaaaagggaggcaagcataagactgaacataatctccatggtctcttcgggcagaag
acaggtcaggccgttggattctcttacacagacgccaataaaaacaaaggcatcacctgg
ggagaggatacactgatggagtatttggagaatcccaagaagtacatccctggaacaaaa
atgatctttgctggcattaagaagaaggcagaaagaaaaatgatagcttatctcaaaaaa
agctactag

  All links  
No link information was found.   
DBGET integrated database retrieval system