KEGG   Pan troglodytes (chimpanzee): 741426Help
Entry
741426            CDS       T01005                                 

Gene name
CYSLTR2
Definition
cysteinyl leukotriene receptor 2
Orthology
K04323  
cysteinyl leukotriene receptor 2
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    741426 (CYSLTR2)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    741426 (CYSLTR2)
G protein-coupled receptors [BR:ptr04030]
 Class A. Rhodopsin family
  Other
   Cysteinyl leukotriene
    741426 (CYSLTR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
13
AA seq 346 aa AA seqDB search
MERKFMSLHPSISVSEMEPNGTFSNNNSRNCTXENFKREFFPIVYLIIFVWGVLGNGLSI
YVFLQPYKKSTSVNVFMLNLAISDLLFISTLPFRADYYLRGSNWIFGDLACRIMSYSLYV
NMYSSIYFLTVLSVVRFLATVHPFRLLHVTSIRSAWILCGIIWILIMASSIMLLDSGSEQ
NGSVTSCLELNLYKIAKLQTMNYIALVVGCLLPFFTLSICYLLIIRVLLKVEVPESGLRV
SHRKALTTIIITLIIFFLCFLPYHTLRTIHLATWKVGICKDRLHKAVVITLALAAANTCF
NPLLYYFAGENFKDRLRSALRKGHPQKAKTKCVFPVSVWLRKETRV
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggagagaaaatttatgtccttgcatccatccatctccgtatcagaaatggaaccaaat
ggcaccttcagcaataacaacagcaggaactgcacanatgaaaacttcaagagagaattt
ttcccaattgtatatctgataatatttgtctggggagtcttgggaaatgggttgtccata
tatgttttcctgcagccttataagaagtccacatctgtgaacgttttcatgctaaatctg
gccatttcagatctcctgttcataagcacgcttcccttcagggctgactattatcttaga
ggctccaattggatatttggagacctggcctgcaggattatgtcttattccttgtatgtc
aacatgtacagcagtatttatttcctgaccgtgctgagtgttgtgcgtttcctggcaacg
gttcacccctttcggcttctgcatgtcaccagcatcaggagtgcctggatcctctgtggg
atcatatggatccttatcatggcttcctcaataatgctcctggacagtggctctgagcag
aacggcagtgtcacatcatgcttagagctgaatctctataaaattgctaagctgcagacc
atgaactatattgccttggtggtgggctgcctgctgccatttttcacactcagcatctgt
tatctgctgatcattcgggttctgttaaaagtggaggtcccagaatcggggctgcgggtt
tctcacaggaaggcactgaccaccatcatcatcaccttgatcatcttcttcttgtgtttc
ctgccctatcacacactgaggaccatccacttggcgacatggaaagtgggtatatgcaaa
gacagactgcataaagctgtggttatcacactggccttggcggcagccaatacctgcttc
aatcctctgctctattactttgctggggagaattttaaggacagactaaggtctgcactc
agaaaaggccatccacagaaggcaaagacaaagtgtgttttccctgttagtgtgtggttg
agaaaggaaacaagagtataa

  All links  
No link information was found.   
DBGET integrated database retrieval system