KEGG   Pan troglodytes (chimpanzee): 741431Help
Entry
741431            CDS       T01005                                 

Gene name
G6PC2
Definition
glucose-6-phosphatase, catalytic, 2
Orthology
K01084  
glucose-6-phosphatase [EC:3.1.3.9]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
FoxO signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Insulin signaling pathway
Adipocytokine signaling pathway
Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    741431 (G6PC2)
   00052 Galactose metabolism
    741431 (G6PC2)
   00500 Starch and sucrose metabolism
    741431 (G6PC2)
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    741431 (G6PC2)
   04151 PI3K-Akt signaling pathway
    741431 (G6PC2)
   04152 AMPK signaling pathway
    741431 (G6PC2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    741431 (G6PC2)
   04920 Adipocytokine signaling pathway
    741431 (G6PC2)
  Digestive system
   04973 Carbohydrate digestion and absorption
    741431 (G6PC2)
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.9  glucose-6-phosphatase
     741431 (G6PC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
2B
AA seq 355 aa AA seqDB search
MDFLHRNGVLIIQHLQKDYRAYYTFLNFMSNVGDPRNIFFIYFPLWFQFNQTVGTKMIWV
AVIGDWLNLIFKWILFGHRPYWWVQETQIYPNHSSPCLEQFPTTCETGPGSPSGHAMGSS
CVWYVMVTAALSHTVCGMDKFSITLHRLTWSFLWSVFWLIQISVCISRVFIATHFPHQVI
LGVIGGMLVAEAFEHTPGIQTASLGTYLKTNLFLFLFALGFYLLLRVLNIDLLWSVPIAK
KWCANPEWIHIDTTPFAGLVRNLGVLFGLGFAINSEMFLLSCRGGNNYTLSFRLLCALTS
LTILQLYHFLQIPTHEEHLFYVLSFCKSASIPLTVVAFIPYCVHMLMKQSGKKSQ
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggatttccttcacaggaatggagtgctcataattcagcatttgcagaaggactaccga
gcttactacacttttctaaattttatgtccaatgttggagacccccggaatatctttttc
atttattttccactttggtttcaatttaatcagacagttggaaccaagatgatatgggta
gcagtcattggggattggttaaatcttatatttaaatggatattatttggtcatcgacct
tactggtgggtccaagaaactcagatttacccaaatcactcaagtccatgccttgaacag
ttccctactacatgtgaaacaggtccaggaagtccatctggccatgcaatgggctcatcc
tgtgtctggtatgtcatggtaacggctgccctgagccacactgtctgtgggatggataag
ttctctatcactctgcacagactgacctggtcatttctttggagtgttttttggttgatt
caaatcagtgtctgcatctccagagtattcatagcaacacattttcctcatcaagttatt
cttggagtaattggtggcatgctggtggcagaggcctttgaacacactccaggcatccaa
acggccagtctgggcacatacctgaagaccaacctctttctcttcctgtttgcacttggc
ttttacctgcttcttagagtgctcaacattgacctgctgtggtccgtgcccatagccaaa
aagtggtgtgccaaccccgaatggatccacattgacaccacgccttttgctggactcgtg
agaaaccttggggtcctctttggcttgggctttgcaatcaactcagagatgttcctcctg
agctgccgagggggaaataactacacactgagcttccggttgctctgtgccttgacctca
ttgacaatactgcagctctaccatttcctccagatcccgactcacgaagagcatttattt
tatgtgctgtctttttgtaaaagtgcatccattcccctaactgtggttgctttcattccc
tactgtgttcatatgttaatgaaacaaagcggaaagaagagtcagtag

DBGET integrated database retrieval system