KEGG   Pan troglodytes (chimpanzee): 741888Help
Entry
741888            CDS       T01005                                 

Gene name
POM121, POM121C
Definition
POM121 transmembrane nucleoporin
Orthology
K14316  
nuclear pore complex protein Nup121
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    741888 (POM121)
Messenger RNA biogenesis [BR:ptr03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     741888 (POM121)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
7
AA seq 1241 aa AA seqDB search
MSPAAAAAGAGERRWPIASVRDGRGRGCGGPAGTALLGLSLVGLLLYLVPAAAALAWLAV
GATAAWWGLSREPRGSRPLSSFVRKARHRRPLSSFVRKARHSRTLFASPPAKSTANGNLL
EPRTLLEGPDPAELLLMGSYMGKPGPPQPAPAPEGQDLRNRPGRRPPARPAPRSPPPSPP
AHRVHHVYPSLPTPLLRLSRRPSPRDRGTLPNRFVITPRRRYPIHQAQYSCLGVLPTVCW
NGYHKKAVLSPRNSRMVCSPVTVRIAPPDRRFSRSAIPEQIISSTLSSPSSNAPDPCAKE
TVLSALKEEKKRTVEEEDQIFLDGQGNKRRCHDSSGSGHSAFEPLVANGVPASFVPKPGS
LKRGLNSQSSDDHLNKRSRSSSMSFLTGAYTSGIPSSSRNAITSSYSSTRGISQLWKRNG
PSSSPFSSPASSCSQTPERPAKKIREEELCHHSSSSTPLAADKESQGEKAADTTPRKKQN
SNSQSTPGSSGQRKRKVQLLPSRRGEQLTLPPPPQLGYSITAEDLDLEKKAALQWFNQAL
EDKSDAASNSVTETPPITQPSFTFTLPAAATASPPTSLLAPSTNPLLESLKKMQTPPSLP
PCPESAGAATTEALSPPKTPSLLPPLGLSQSGPPGPLPSPSLDSKPLTTLLGLIPAPSTV
PATDTKAPPTLQAETATKPLQAETATKPQATSAPSPAPKQSFLFGTQNTSPSSPAAPAAS
SASPMFKPIFTAPPKSEKEGLTPPGPSVTATAPSSSSLPTTTSTTAPTFQPVFSSMGPPA
SVPLPAPFFKQTTTPTTAPTTTAPLFTGLASATSAVAPITSASPSTDSASKPAFGFGINS
VSSSSVSTTTSTATAASQPFLFGAPQASAASFIPAMGSIFQFGKPPALPTTTTVTTFSQS
LPTAVPTATSSGAAGFSGFGSTLTTSAPATSSNTSTPTFNIPFGSSAKSLLPSYPGANPQ
PTFGAAEGQPPGAAKPALAPSFGSSFTFGNSAAPAAAPTPALVSMIKVVPAYVPTPIHPI
FGGATHSAFGLKATASAFGAPASSQPAFGGSTAVFPFGAATSSGFGATTQTASSGSSSSV
FGSTTPSPFTFGGSAAPAGSGSFGINVATPGSSTTAGAFSFGAGQSGSTATSTPFAGGLG
QNALGTTGQSTPFAFNVGSTPESKPVFGGTATPTFGLNTPAPGVGTSGSSLSFGASSAPA
QGFVGVAPFGSAALSFSIGVGSKTLGARQRLQARRQHTRKK
NT seq 3726 nt NT seq  +upstreamnt  +downstreamnt
atgtctccggcggctgcggcggctggagcaggcgagcggcggtggcccatagcgagtgtc
agggacggccggggccggggctgcggcgggccggccgggacggcgctcctgggcctgtcg
ctggttggcctcctactgtacctcgtgccggctgcggctgcactggcctggctggccgtg
ggggctaccgcggcctggtggggactgagccgcgagccccgaggttcgcgccccttgtcc
tccttcgttcggaaggcgcgtcatcggcgccccttgtcctcattcgttcggaaggcgcgt
catagtcgaacactgttcgcttcgcctccggccaagtcgacagccaacggaaacctccta
gagccgcggaccctgctcgaaggacctgaccctgcggaactgctactcatgggcagttac
atgggcaagcccgggccgccgcagcccgcccccgctccggagggccaggacctgcggaat
aggcctggccgccgcccacccgcccgcccggcgccgcgctccccaccgccctccccgccg
gcccatcgcgttcaccacgtttacccctctctccctactcctcttctccgactctccagg
aggccttccccacgggatcgtgggactttaccaaatcggtttgtaataacacctcggaga
cgctatccgatccatcaggcccagtattcctgtctgggggtacttcccacagtgtgctgg
aatggttatcacaagaaggctgtgctgtcccctcgcaactccaggatggtgtgtagccca
gtgactgtgaggatcgcccctcctgacagaagattttcgcgttctgcgataccagagcag
ataatcagctcaacactgtcctcaccatcaagtaacgccccagacccatgtgcaaaggag
actgtactgagtgccctcaaagaggagaagaaaaggacagtggaggaagaagaccaaata
ttccttgatggccagggaaataaaagaaggtgccatgatagcagtggcagtggacattca
gcatttgagcccctggtggccaatggagtccccgcttcttttgtgcctaagcctgggtct
ctgaagagaggcctcaattctcagagctcagatgaccacttgaataagagatcccgaagc
tcttccatgagcttcttgacaggcgcttacacaagtggcatccctagctccagccgcaat
gccattaccagttcctacagctccactcgaggcatctcgcagctctggaagagaaatggc
cccagttcatcacccttctctagcccagcctcctcctgctcccagacaccggagaggcca
gcaaagaaaataagagaagaggagctgtgtcatcattccagttcttcaactccattggca
gcagacaaggagtcccagggagaaaaggctgcagatacaaccccaaggaagaaacaaaac
tcgaattctcagtctacacctggcagctctgggcagcgtaagcggaaagttcagctgctg
ccttctcggcgaggggaacagctgaccttgcctccacctccccagcttggctattcgatc
actgccgaggacctagacttagagaagaaggctgcattacagtggttcaaccaggccttg
gaggacaagagcgatgctgcctcgaactctgtcactgagaccccacctatcactcagcct
tcatttacctttaccctgcctgctgctgcaactgcctccccacccacctccctcctggcc
ccaagcaccaacccactgttagagagcttgaagaagatgcagactcccccgagcctgcca
ccctgcccagaatctgctggagcagcaaccactgaggccctctcacctccaaagacaccc
agcctcctacccccgctgggtttatcacagtcagggccgccagggccactccccagcccc
tccttagactccaaacccctgaccactttgctggggctgatccctgctccatccacggta
ccagccactgacaccaaggcacctccaacccttcaggcagagacggctaccaaacccctt
caggcagagacggctaccaaaccccaagccacatctgccccgtcccccgcccccaagcaa
agcttcctgtttggaacacagaacacctcaccttccagccctgccgcccctgctgcatct
tcagcatctcccatgttcaagcccattttcacggccccacccaagagtgagaaggaaggc
ctcacaccgcctggcccttcagtcacagccacagcgccctccagctcctccctccccacg
accaccagcaccacagccccgaccttccagcctgtctttagcagcatggggccacctgca
tctgtgcccttgcctgctcccttcttcaagcagacaactactcccaccactgctcccacc
acaactgccccgctcttcactggcctggccagcgccacctctgctgtggctcccatcacc
tctgccagtccatccacagactctgcttcaaagcctgcgtttggctttggcataaacagt
gtgagcagcagcagtgtgagtaccacgaccagcaccgccactgccgcctcacagcctttc
ctctttggggcgccccaggcctctgctgccagcttcatcccggccatgggctccatattc
caatttggcaaacctcctgccctgcccacaaccaccacagtcaccaccttcagccagtcc
ctgcccactgccgtgccaacggccaccagcagcggcgctgccggctttagcggttttggc
agcaccctcaccacctccgccccggccaccagcagtaacacgagcacccccacgttcaac
attccctttggctcaagcgccaagtccctgctcccatcatatccgggagccaacccccag
cccacatttggggctgctgaggggcagccaccaggggccgccaagccggcccttgccccc
agctttggcagctctttcacttttggaaactctgcagccccggctgctgcacccacacct
gcacttgtgtccatgatcaaggtcgtgcctgcgtacgtgcctacgcccatccaccctatc
tttggtggtgccacgcactcggcgtttgggttgaaagccacggcttcggccttcggcgct
cccgccagctcacagcccgcctttggtggctccactgctgtcttccccttcggtgcagcc
accagctccggctttggagccaccacccagaccgccagcagcgggagcagcagctcagtg
tttggcagcacaacaccatcacccttcacgtttgggggttcggcagcccccgctggcagt
gggagctttgggatcaatgtggccaccccaggctccagcaccaccgccggagctttcagc
tttggagcaggacagagtgggagcacagccacctccacccccttcgcagggggcttaggt
cagaacgccctgggcaccaccggccagagcacaccgtttgccttcaacgtgggcagcaca
cctgagagcaaacctgtgtttggaggcaccgccacccccacctttggtctgaacacccct
gcgcctggagtgggcacatcgggcagcagcctctcctttggggcatcctcagcacccgcc
caaggctttgttggtgttgcacctttcggatcggcagccctttcattttccattggtgtg
ggatccaagaccctaggggctcgacagcgactgcaggcccgaaggcagcacacccgcaaa
aagtag

DBGET integrated database retrieval system