KEGG   Pan troglodytes (chimpanzee): 742508Help
Entry
742508            CDS       T01005                                 

Gene name
ANGPT2
Definition
angiopoietin 2
Orthology
K05466  
angiopoietin 2
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Ras signaling pathway
Rap1 signaling pathway
HIF-1 signaling pathway
PI3K-Akt signaling pathway
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    742508 (ANGPT2)
   04015 Rap1 signaling pathway
    742508 (ANGPT2)
   04066 HIF-1 signaling pathway
    742508 (ANGPT2)
   04151 PI3K-Akt signaling pathway
    742508 (ANGPT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
8
AA seq 444 aa AA seqDB search
MWQIVFFTLSCDLVLAAAYNNFRKSMDSIGKKQYQVQHGSCSYTFLLPEMDNCRSSSSPY
VSNAVQRDAPLEYDDSVQRLQVLENIMENNTQWLMKVLNQTTRLELQLLEHSLSTNKLEK
QILDQTSEINKLQDKNSFLEKKVLAMEDKHIIQLQSIKEEKDQLQVLVSKQNSIIEELEK
KIVTATVNNSVLQKQQHDLMETVNNLLTMMSTSNSAKDPTVAKEEQISFRDCAEVFKSGH
TTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGE
YWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGK
ISSISQPGNDFSTKDADNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGI
KWYYWKGSGYSLKATTMMIRPADF
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgtggcagattgttttctttactctgagctgtgatcttgtcttggccgcagcctataac
aactttcggaagagcatggacagcataggaaagaagcaatatcaggtccagcatgggtcc
tgcagctacactttcctcctgccagagatggacaactgccgctcttcctccagcccctac
gtgtccaatgctgtgcagagggacgcgccgctcgaatacgatgactcggtgcagaggctg
caagtgctggagaacatcatggaaaacaacactcagtggctaatgaaggtattaaatcag
accacgagacttgaacttcagctcttggaacactccctctcgacaaacaaattggaaaaa
cagattttggaccagaccagtgaaataaacaaattgcaagataagaacagtttcctagaa
aagaaggtgctagctatggaagacaagcacatcatccaactacagtcaataaaagaagag
aaagatcagctacaggtgttagtatccaagcaaaattccatcattgaagaactagaaaaa
aaaatagtgactgccacggtgaataattcagttcttcaaaagcagcaacatgatctcatg
gagacagttaataacttactgactatgatgtccacatcaaactcagctaaggaccccact
gttgctaaagaagaacaaatcagtttcagagactgtgctgaagtattcaaatcaggacac
accacgaatggcatctacacgttaacattccctaattctacagaagagatcaaggcctac
tgtgacatggaagctggaggaggcgggtggacaattattcagcgacgtgaggatggcagc
gttgattttcagaggacttggaaagaatataaagtgggatttggtaacccttcaggagaa
tattggctgggaaatgagtttgtttcgcaactgactaatcagcaacgctatgtgcttaaa
atacaccttaaagactgggaagggaatgaggcttactcattgtatgaacacttctatctc
tcaagtgaagaactcaattataggattcaccttaaaggacttacagggacagccggcaaa
ataagcagcatcagccaaccaggaaatgattttagcacaaaggatgcagacaacgacaaa
tgtatttgcaaatgttcacaaatgctaacaggaggctggtggtttgatgcatgtggtcct
tccaacttgaacggaatgtactatccacaaaggcagaacacaaataagttcaacggcatt
aaatggtactactggaaaggctcaggctattcgctcaaggccacaaccatgatgatccga
ccagcagatttctga

DBGET integrated database retrieval system