KEGG   Pan troglodytes (chimpanzee): 742508Help
Entry
742508            CDS       T01005                                 

Gene name
ANGPT2
Definition
(RefSeq) angiopoietin-2 isoform X2
  KO
K05466  angiopoietin 2
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04010  MAPK signaling pathway
ptr04014  Ras signaling pathway
ptr04015  Rap1 signaling pathway
ptr04066  HIF-1 signaling pathway
ptr04151  PI3K-Akt signaling pathway
ptr05167  Kaposi's sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    742508 (ANGPT2)
   04015 Rap1 signaling pathway
    742508 (ANGPT2)
   04010 MAPK signaling pathway
    742508 (ANGPT2)
   04066 HIF-1 signaling pathway
    742508 (ANGPT2)
   04151 PI3K-Akt signaling pathway
    742508 (ANGPT2)
 Human Diseases
  Infectious diseases
   05167 Kaposi's sarcoma-associated herpesvirus infection
    742508 (ANGPT2)
Cytokines and growth factors [BR:ptr04052]
 Growth factors
  Growth factors (RTK binding)
   742508 (ANGPT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fibrinogen_C
Motif
Other DBs
NCBI-GeneID: 742508
NCBI-ProteinID: XP_001145488
Ensembl: ENSPTRG00000019947
UniProt: A0A2J8JJZ1
Position
8
AA seq 495 aa AA seqDB search
MWQIVFFTLSCDLVLAAAYNNFRKSMDSIGKKQYQVQHGSCSYTFLLPEMDNCRSSSSPY
VSNAVQRDAPLEYDDSVQRLQVLENIMENNTQWLMKLENYIQDNMKKEMVEIQQNAVQNQ
TAVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSE
INKLQDKNSFLEKKVLAMEDKHIIQLQSIKEEKDQLQVLVSKQNSIIEELEKKIVTATVN
NSVLQKQQHDLMETVNNLLTMMSTSNSKDPTVAKEEQISFRDCAEVFKSGHTTNGIYTLT
FPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVS
QLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGN
DFSTKDADNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSG
YSLKATTMMIRPADF
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgtggcagattgttttctttactctgagctgtgatcttgtcttggccgcagcctataac
aactttcggaagagcatggacagcataggaaagaagcaatatcaggtccagcatgggtcc
tgcagctacactttcctcctgccagagatggacaactgccgctcttcctccagcccctac
gtgtccaatgctgtgcagagggacgcgccgctcgaatacgatgactcggtgcagaggctg
caagtgctggagaacatcatggaaaacaacactcagtggctaatgaagcttgagaattat
atccaggacaacatgaaaaaagaaatggtagagatacagcagaatgcagtacagaaccag
acggctgtgatgatagaaatagggacaaacctgttgaaccaaacagcggagcaaacacgg
aagttaactgatgtggaagcccaagtattaaatcagaccacgagacttgaacttcagctc
ttggaacactccctctcgacaaacaaattggaaaaacagattttggaccagaccagtgaa
ataaacaaattgcaagataagaacagtttcctagaaaagaaggtgctagctatggaagac
aagcacatcatccaactacagtcaataaaagaagagaaagatcagctacaggtgttagta
tccaagcaaaattccatcattgaagaactagaaaaaaaaatagtgactgccacggtgaat
aattcagttcttcaaaagcagcaacatgatctcatggagacagttaataacttactgact
atgatgtccacatcaaactctaaggaccccactgttgctaaagaagaacaaatcagtttc
agagactgtgctgaagtattcaaatcaggacacaccacgaatggcatctacacgttaaca
ttccctaattctacagaagagatcaaggcctactgtgacatggaagctggaggaggcggg
tggacaattattcagcgacgtgaggatggcagcgttgattttcagaggacttggaaagaa
tataaagtgggatttggtaacccttcaggagaatattggctgggaaatgagtttgtttcg
caactgactaatcagcaacgctatgtgcttaaaatacaccttaaagactgggaagggaat
gaggcttactcattgtatgaacacttctatctctcaagtgaagaactcaattataggatt
caccttaaaggacttacagggacagccggcaaaataagcagcatcagccaaccaggaaat
gattttagcacaaaggatgcagacaacgacaaatgtatttgcaaatgttcacaaatgcta
acaggaggctggtggtttgatgcatgtggtccttccaacttgaacggaatgtactatcca
caaaggcagaacacaaataagttcaacggcattaaatggtactactggaaaggctcaggc
tattcgctcaaggccacaaccatgatgatccgaccagcagatttctga

DBGET integrated database retrieval system