KEGG   Pan troglodytes (chimpanzee): 742723Help
Entry
742723            CDS       T01005                                 

Gene name
PDIA3
Definition
(RefSeq) protein disulfide-isomerase A3 precursor
  KO
K08056  protein disulfide isomerase family A, member 3 [EC:5.3.4.1]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04141  Protein processing in endoplasmic reticulum
ptr04612  Antigen processing and presentation
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    742723 (PDIA3)
 Organismal Systems
  Immune system
   04612 Antigen processing and presentation
    742723 (PDIA3)
Enzymes [BR:ptr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     742723 (PDIA3)
Chaperones and folding catalysts [BR:ptr03110]
 Protein folding catalysts
  Protein disulfide isomerase
   742723 (PDIA3)
Membrane trafficking [BR:ptr04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    742723 (PDIA3)
Exosome [BR:ptr04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   742723 (PDIA3)
  Exosomal proteins of colorectal cancer cells
   742723 (PDIA3)
  Exosomal proteins of bladder cancer cells
   742723 (PDIA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin Thioredoxin_6 Thioredoxin_2 Thioredoxin_8 Thioredoxin_7 AhpC-TSA OST3_OST6 Thioredoxin_4 Thioredoxin_3
Motif
Other DBs
NCBI-GeneID: 742723
NCBI-ProteinID: NP_001233381
Ensembl: ENSPTRG00000007002
UniProt: G2HFN6
Position
15
AA seq 505 aa AA seqDB search
MRLRRLALFPGVALLLAAARLAAASDVLELTDDNFESRISDTGSAGLMLVEFFAPWCGHC
KRLAPEYEAAATRLKGIVPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGEEAGAYDGPRT
ADGIVSHLKKQAGPASVPLRTEEEFKKFISDKDASIVGFFDDSFSEAHSEFLKAASNLRD
NYRFAHTNVESLVNEYDDNGEGIILFRPSHLTNKFEDKTVAYTEQKMTSGKIKKFIQENI
FGICPHMTEDNKDLIQGKDLLIAYYDVDYEKNAKGSNYWRNRVMMVAKKFLDAGHKLNFA
VASRKTFSHELSDFGLESTAGEIPVVAIRTAKGEKFVMQEEFSRDGKALERFLQDYFDGN
LKRYLKSEPIPESNDGPVKVVVAENFDEIVNNENKDVLIEFYAPWCGHCKNLEPKYKELG
EKLSKDPNIVIAKMDATANDVPSPYEVRGFPTIYFSPANKKLNPKKYEGGRELSDFISYL
QREATNPPVIQEEKPKKKKKAQEDL
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgcgcctccgccgcctagcgctgttcccgggtgtggcgctgcttcttgccgcggcccgc
ctcgccgctgcctccgacgtgctagaactcacggacgacaacttcgagagtcgcatctcc
gacacgggctctgcgggcctcatgctcgtcgagttcttcgccccctggtgtggacactgc
aagagacttgcgcctgagtatgaagctgcagctaccagattaaaaggaatagtcccatta
gcaaaggttgattgcactgccaacactaacacctgtaataaatatggagtcagtggatat
ccaaccctgaagatatttagagatggtgaagaagcaggtgcttatgatggacctaggact
gctgatggaattgtcagccacctgaagaagcaagcaggaccagcttcagtgcctctcagg
actgaggaagaatttaagaaattcattagtgataaagatgcctctatagtaggttttttc
gatgattcattcagtgaggctcactccgagttcctaaaagcagccagcaacttgagggat
aactaccgatttgcacatacgaatgttgagtctctggtgaacgagtatgatgataatgga
gagggtatcatcttatttcgtccttcacatctcactaacaagtttgaggacaagactgtg
gcatatacagagcaaaaaatgaccagtggcaaaattaaaaagtttatccaggaaaacatt
tttggtatctgccctcacatgacagaagacaataaagatttgatacagggcaaggactta
cttattgcttactatgatgtggactatgaaaagaatgctaaaggttccaactactggaga
aacagggtaatgatggtggcaaagaaattcctggatgctgggcacaaactcaactttgct
gtagctagccgcaaaacctttagccatgaactttctgattttggcttggagagcactgct
ggagagattcctgttgttgctatcagaactgctaaaggagagaagtttgtcatgcaggag
gagttctcgcgtgatgggaaggctctggagaggttcctgcaggattactttgatggcaat
ctgaagagatacctgaagtctgaacctatcccagagagcaatgatgggcctgtgaaggta
gtggtagcagagaattttgatgaaatagtgaataatgaaaataaagatgtgctgattgaa
ttttatgccccttggtgtggtcactgtaagaacctggagcccaagtataaagaacttggc
gagaagctcagcaaagacccaaatatcgtcatagccaagatggatgccacagccaatgat
gtgccttctccatatgaagtcagaggttttcctaccatatacttctctccagccaacaag
aagctaaatccaaagaaatatgaaggtggccgtgaattaagtgattttattagctatcta
caaagagaagctacaaacccccctgtaattcaagaagaaaaacccaagaagaagaagaag
gcacaggaggatctctaa

DBGET integrated database retrieval system