KEGG   Pan troglodytes (chimpanzee): 742890Help
Entry
742890            CDS       T01005                                 

Gene name
UGT2A1
Definition
UDP-glucuronosyltransferase 2A1
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Chemical carcinogenesis
Module
Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    742890 (UGT2A1)
   00053 Ascorbate and aldarate metabolism
    742890 (UGT2A1)
   00500 Starch and sucrose metabolism
    742890 (UGT2A1)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    742890 (UGT2A1)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    742890 (UGT2A1)
   00860 Porphyrin and chlorophyll metabolism
    742890 (UGT2A1)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    742890 (UGT2A1)
   00982 Drug metabolism - cytochrome P450
    742890 (UGT2A1)
   00983 Drug metabolism - other enzymes
    742890 (UGT2A1)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    742890 (UGT2A1)
Enzymes [BR:ptr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     742890 (UGT2A1)
Glycosyltransferases [BR:ptr01003]
 Others
  Hydrophobic molecule
   742890 (UGT2A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 737 aa AA seqDB search
MLNNLLLFSLQISLIGTTLGGNVLIWPMEGSHWLNVKIIIDELIKKEHNVTVLVASGALF
ITPTSNPSLTFEIYKVPFGKERIEGVIKDFVLTWLENRPSPSTIWRFYQEMAKVIKDFHM
VSQEICDGVLKNQQLMEKLKKSKFEVLVSDPVFPCGDIVALKLGIPFMYSLRFSPASTVE
KHCGKVPYPPSYVPAVLSELTDQMSFTDRIRNFISYHLQDYMFETLWKSWDSYYSKALDG
SHWLNIKIILEELIQRNHNVTVLASSATLFINSNPDSPVNFEVIPVSYKKSNIDSLIEHM
IMLWIDHRPTPLTIWAFYKELGKLLDTFFQINIQLCDGVLKNPKLMARLQKGGFDVLVAD
PVTICGDLVALKLGIPFMYTLRFSPASTVERHCGKIPAPVSYVPAALSELTDQMTFGERI
KNTISYSLQDYIFQSYWGEWNSYYSKILGRPTTLCETMGKAEIWLIRTYWDFEFPRPYLP
NFEFVGGLHCKPAKPLPKEMEEFIQSSGKDGVVVFSLGSMVKNLTEEKANLIASALAQIP
QKVLWRYKGKKPATLGNNTQLFDWIPQNDLLGHPKTKAFITHGGTNGIYEAIYHGVPMVG
IPMFADQPDNIAHMKAKGAAVEVNLNTMTSVDLLSALRTVINEPSYKENAMRLSRIHHDQ
PVKPLDRAVFWIEFVMRHKGAKHLRVAAHNLTWFQYHSLDVIGFLLVCVTTAIFLVIQCC
LFSCQKFVKIGKKKKRE
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgttaaacaaccttctgctgttctcccttcagataagtctcataggaaccactcttggt
gggaatgttttgatttggccaatggaaggtagtcattggctaaatgttaagataattata
gatgagctcattaaaaaggagcataatgtgactgtcctagttgcctctggtgcacttttc
atcacaccaacctctaacccatctctgacatttgaaatatataaggtgccctttggcaaa
gaaagaatagaaggagtaattaaggacttcgttttgacatggctggaaaatagaccatct
ccttcaaccatttggagattctatcaggagatggccaaagtaatcaaggacttccacatg
gtgtctcaggagatctgtgatggcgttcttaaaaaccaacagctgatggaaaagctaaag
aaaagcaagtttgaagtcctggtgtctgatccagtatttccttgtggcgatatagtagct
ttaaaacttggaataccatttatgtactccttgaggttttctccagcctcaacagtggaa
aagcactgtgggaaggtaccataccctccttcctatgttcctgctgttttatcagaactc
accgaccaaatgtctttcactgacagaataagaaatttcatctcctaccacctacaggac
tacatgtttgaaactctttggaaatcatgggattcatactatagtaaagctttagatggt
agccattggttaaatattaagattattctagaagagttgattcaaagaaatcacaatgtg
actgtactggcttcatcagcaactctattcatcaactccaatcccgattctcctgtgaat
tttgaagtgatacctgtttcctacaagaagagcaatatagattccttaattgagcatatg
ataatgctgtggattgaccatagaccaactcctctcacaatatgggctttctacaaagaa
ctaggaaaacttctagacactttctttcaaattaacatacaactctgtgatggtgtacta
aagaacccaaagttgatggcaagacttcagaaaggtggttttgatgtgttggtagcagac
ccagtaacaatctgtggtgatcttgttgctctgaaattaggaattccatttatgtacaca
ttgaggttctctccagcatcaacagtggagagacactgtgggaaaatcccagcaccagtc
tcctatgtaccggcagccttatcagagctcactgaccagatgacctttggtgaaaggatt
aaaaataccatatcttattctctgcaagactatatatttcagtcctactggggagaatgg
aattcatactatagcaaaattttaggaagacccactacgttatgtgagactatggggaaa
gctgaaatttggttaatccgaacatattgggattttgaatttcctcgtccatacttacct
aattttgagtttgttggaggattgcactgcaaacctgccaaacctttacctaaggaaatg
gaagaatttatccagagctcaggtaaagatggtgttgtggtgttttctctgggatcaatg
gtcaaaaaccttacagaagaaaaggccaatcttattgcctcagcccttgcccagattcca
cagaaggttttatggagatacaaaggaaagaaaccagccacattaggaaacaatactcag
ctctttgattggataccccagaatgatcttcttggacatcccaaaaccaaagcttttatc
actcatggtggaactaatgggatctacgaagctatttaccacggagtccctatggtggga
attcccatgtttgctgatcagcctgataacattgctcacatgaaggccaaaggagcagct
gtggaagtgaacctaaacacaatgacaagtgtggatttgcttagcgctttgagaacagtc
attaatgaaccttcttataaagagaatgctatgaggttatcaagaattcaccatgatcaa
cctgtaaagcccctggatcgagcagtcttctggatcgagtttgtcatgcgccacaaagga
gccaagcaccttcgggttgcagcccacaacctcacctggttccagtaccactctttggat
gtaattgggttcttgctggtctgtgtgacaacggctatatttttggtcatacaatgttgt
ttgttttcctgtcaaaaatttgttaagataggaaagaagaaaaaaagagaatag

DBGET integrated database retrieval system