KEGG   Pan troglodytes (chimpanzee): 742890Help
Entry
742890            CDS       T01005                                 

Gene name
UGT2A2
Definition
(RefSeq) UDP-glucuronosyltransferase 2A2 isoform X3
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr00040  Pentose and glucuronate interconversions
ptr00053  Ascorbate and aldarate metabolism
ptr00140  Steroid hormone biosynthesis
ptr00830  Retinol metabolism
ptr00860  Porphyrin and chlorophyll metabolism
ptr00980  Metabolism of xenobiotics by cytochrome P450
ptr00982  Drug metabolism - cytochrome P450
ptr00983  Drug metabolism - other enzymes
ptr01100  Metabolic pathways
ptr05204  Chemical carcinogenesis
Module
ptr_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    742890 (UGT2A2)
   00053 Ascorbate and aldarate metabolism
    742890 (UGT2A2)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    742890 (UGT2A2)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    742890 (UGT2A2)
   00860 Porphyrin and chlorophyll metabolism
    742890 (UGT2A2)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    742890 (UGT2A2)
   00982 Drug metabolism - cytochrome P450
    742890 (UGT2A2)
   00983 Drug metabolism - other enzymes
    742890 (UGT2A2)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    742890 (UGT2A2)
Enzymes [BR:ptr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     742890 (UGT2A2)
Glycosyltransferases [BR:ptr01003]
 Others
  Hydrophobic molecule
   742890 (UGT2A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C Pro_3_hydrox_C
Motif
Other DBs
NCBI-GeneID: 742890
NCBI-ProteinID: XP_009446068
UniProt: H2R065
Position
4
AA seq 527 aa AA seqDB search
MLNNLLLFSLQISLIGTTLGGNVLIWPMEGSHWLNVKIIIDELIKKEHNVTVLVASGALF
ITPTSNPSLTFEIYKVPFGKERIEGVIKDFVLTWLENRPSPSTIWRFYQEMAKVIKDFHM
VSQEICDGVLKNQQLMEKLKKSKFEVLVSDPVFPCGDIVALKLGIPFMYSLRFSPASTVE
KHCGKVPYPPSYVPAVLSELTDQMSFTDRIRNFISYHLQDYMFETLWKSWDSYYSKALGR
PTTLCETMGKAEIWLIRTYWDFEFPRPYLPNFEFVGGLHCKPAKPLPKEMEEFIQSSGKD
GVVVFSLGSMVKNLTEEKANLIASALAQIPQKVLWRYKGKKPATLGNNTQLFDWIPQNDL
LGHPKTKAFITHGGTNGIYEAIYHGVPMVGIPMFADQPDNIAHMKAKGAAVEVNLNTMTS
VDLLSALRTVINEPSYKENAMRLSRIHHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAAHN
LTWFQYHSLDVIGFLLVCVTTAIFLVIQCCLFSCQKFGKIGKKKKRE
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgttaaacaaccttctgctgttctcccttcagataagtctcataggaaccactcttggt
gggaatgttttgatttggccaatggaaggtagtcattggctaaatgttaagataattata
gatgagctcattaaaaaggagcataatgtgactgtcctagttgcctctggtgcacttttc
atcacaccaacctctaacccatctctgacatttgaaatatataaggtgccctttggcaaa
gaaagaatagaaggagtaattaaggacttcgttttgacatggctggaaaatagaccatct
ccttcaaccatttggagattctatcaggagatggccaaagtaatcaaggacttccacatg
gtgtctcaggagatctgtgatggcgttcttaaaaaccaacagctgatggaaaagctaaag
aaaagcaagtttgaagtcctggtgtctgatccagtatttccttgtggcgatatagtagct
ttaaaacttggaattccatttatgtactccttgaggttttctccagcctcaacagtggaa
aagcactgtgggaaggtaccataccctccttcctatgttcctgctgttttatcagaactc
accgaccaaatgtctttcactgacagaataagaaatttcatctcctaccacctacaggac
tacatgtttgaaactctttggaaatcatgggattcatactatagtaaagctttaggaaga
cccactacgttatgtgagactatggggaaagctgaaatttggttaatccgaacatattgg
gattttgaatttcctcgtccatacttacctaattttgagtttgttggaggattgcactgc
aaacctgccaaacctttacctaaggaaatggaagaatttatccagagctcaggtaaagat
ggtgttgtggtgttttctctgggatcaatggtcaaaaaccttacagaagaaaaggccaat
cttattgcctcagcccttgcccagattccacagaaggttttatggagatacaaaggaaag
aaaccagccacattaggaaacaatactcagctctttgattggataccccagaatgatctt
cttggacatcccaaaaccaaagcttttatcactcatggtggaactaatgggatctacgaa
gctatttaccacggagtccctatggtgggaattcccatgtttgctgatcagcctgataac
attgctcacatgaaggccaaaggagcagctgtggaagtgaacctaaacacaatgacaagt
gtggatttgcttagcgctttgagaacagtcattaatgaaccttcttataaagagaatgct
atgaggttatcaagaattcaccatgatcaacctgtaaagcccctggatcgagcagtcttc
tggatcgagtttgtcatgcgccacaaaggagccaagcaccttcgggttgcagcccacaac
ctcacctggttccagtaccactctttggatgtaattgggttcttgctggtctgtgtgaca
acggctatatttttggtcatacaatgttgtttgttttcctgtcaaaaatttggtaagata
ggaaagaagaaaaaaagagaatag

DBGET integrated database retrieval system