KEGG   Pan troglodytes (chimpanzee): 742929Help
Entry
742929            CDS       T01005                                 

Gene name
USP18
Definition
ubiquitin specific peptidase 18
Orthology
K11846  
ubiquitin carboxyl-terminal hydrolase 18/41 [EC:3.1.2.15]
Organism
ptr  Pan troglodytes (chimpanzee)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
22
AA seq 372 aa AA seqDB search
MSKAFGLLRQICQSILAESSQSPADLEEKKEEDSNMKREQPRERPRAWDYPHGLVGLHNI
GQTCCLNSLIQVFVMNVDFTRILKRITVPRGADEQRRSVPFQMLLLLEKMQDSRQKAVRP
LELAYCLQKYNVPLFVQHDAAQLYLKLWNLIKDQIADVHLVERLQDLYTIRVKDSLICVD
CAMESSRNSSMLTLPLSLFDVDSKPLKTLEDALHCFFQPRELSSKSKCFCENCGKKTRGK
QVLKLTHLPQTLTIHLMRFSIRNSQTRKICHSLYFPQSLDFSQILPMKRESCDAEEQSRG
QYELFAVIAHVGMADSGHYCVYIRNAVDGKWFCFNDSNICLVSWEDIQCTYGNPNYHWQE
TAYLLVYMKMEC
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaggcgtttggtctcctgagacaaatctgtcagtccatcctggctgagtcctcg
cagtccccggcagatcttgaagaaaagaaggaagaagacagcaacatgaagagagagcag
cccagagagcgtcccagggcctgggactaccctcatggcctggttggtttacacaatatt
ggacagacctgctgccttaactccttgattcaggtgttcgtaatgaatgtggacttcacc
aggatattgaagaggatcacggtgcccaggggagctgacgagcagaggagaagcgtccct
ttccagatgcttctgctgctggagaagatgcaggacagccggcagaaagcagtgcggccc
ctggagctggcctactgcctgcagaagtacaacgtgcccttgtttgtccaacatgatgct
gcccaactgtacctcaaactctggaacctgattaaggaccagatcgctgatgtgcacttg
gtggagagactgcaggacctgtatacgatccgggtgaaggactccttgatttgcgttgac
tgtgccatggagagtagcagaaacagcagcatgctcaccctcccactttctctttttgat
gtggactcaaagcccctgaagacactggaggatgccctgcactgcttcttccagcccagg
gagttatcaagcaaaagcaagtgcttctgtgagaactgtgggaagaagacccgtgggaaa
caggtcttgaagctgacccatttgccccagaccctgacaatccacctcatgcgattctcc
atcaggaattcacagacgagaaagatctgccactccctgtacttcccccagagcttggat
ttcagccagatccttccaatgaagcgagagtcttgtgatgctgaggagcagtccagaggg
cagtatgagctttttgctgtgattgcgcacgtgggaatggcagactccggtcattactgt
gtctacatccggaatgctgtggatggaaaatggttctgcttcaatgactccaatatttgc
ttggtatcctgggaagacatccagtgtacctatggaaatcctaactaccactggcaggaa
actgcatatcttctggtttacatgaagatggagtgctaa

DBGET integrated database retrieval system