KEGG   Pan troglodytes (chimpanzee): 742992Help
Entry
742992            CDS       T01005                                 

Gene name
USP36
Definition
ubiquitin specific peptidase 36
Orthology
K11855  
ubiquitin carboxyl-terminal hydrolase 36/42 [EC:3.1.2.15]
Organism
ptr  Pan troglodytes (chimpanzee)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
17
AA seq 1037 aa AA seqDB search
MPIVDKLKEALKPGRKDSADDGELGKLLASSAKKVLLQKIEFEPASKSFSYQLEALKSKY
VLLNPKTEGASRHKSGDDPPARRQGSEHTYESCGDGVPAPQKVLFPTERLSLRWERVFRV
GAGLHNLGNTCFLNATIQCLTYTPPLANYLLSKEHARSCHQGSFCMLCVMQNHIVQAFAN
SGNAIKPVSFIRDLKKIARHFRFGNQEDAHEFLRYTIDAMQKACLNGCAKLDRQTQATTL
VHQIFGGYLRSRVKCSVCKSVSDTYDPYLDVALEIRQAANIVRALELFVKADVLSGENAY
MCAKCKKKVPASKRFTIHRTSNVLTLSLKRFANFSGGKITKDVGYPEFLNIRPYMSQNNG
DPVMYGLYAVLVHSGYSCHAGHYYCYVKASNGQWYQMNDSLVHSSNVKVVLNQQAYVLFY
LRIPGSKKSPEGLISRTGSSSLPGRPSVIPDHSKKNIGNGIISSPLTGKRQDSGMMKKPH
ITEEIGVPISRNGSTLGLKSQNGCIPPKLPSGSPSPKLSQTPTHMPTILDDPGKKVKKPA
PPQHFSPRTAQELPGTSNSNSSRSGSQRQGSWDSRDVVLSTSPKLLATATANGHGLKGND
ESAGLDRRGSSSSSPEHSASSDSTKAPQTPRSGAAHLCGSQETNCSTAGPSKTPPSGADS
KTVKLKSPVLSNTTTEPASTMSPPPAKKLALSAKKASTLWRATGNDLRPPPPSPSSDLTH
PMKTSHPVVASTWPVHRARAVSPAPQSSSRLQPPFSPHPTLLSSTPKPPGTSEPRSCSSI
STALPQVNEDLVSLPHQLPEASEPPRSPSEKRKKTFVGELQRLGSETRLPQHIREATAAP
HGKRKRKKKKRPEDTAASALQEGQTQRQPGSPTHRREGQAQLPAVRRQEDGTQPQVNGQQ
VGCVTDGHHASSRKRRRKGAEGLGEEGGLHQDPPWHSCSPMGDGDPEAMEESPRKKKKKK
RKQEPQESTTGPDWMPDVGGQSDAMKTADSPTETEKKIKKFKREKRRNFNAFQKLQTRRN
FWSVTHPAKAASLSYRR
NT seq 3114 nt NT seq  +upstreamnt  +downstreamnt
atgccaatagtggataagttgaaggaggccctgaaacccggccgcaaggactcggctgat
gatggagaactggggaagcttcttgcctcctctgccaagaaggtccttttacagaaaatc
gagttcgagccagccagcaagagcttctcctaccagctggaggccttaaagagcaaatat
gtgttgctcaaccccaaaacagagggagctagtcgccacaagagtggagatgacccaccg
gccaggagacagggcagtgagcacacgtatgagagctgtggtgacggagtcccagccccg
cagaaagtgctcttccccacggagcgactgtctctgaggtgggagcgggtcttccgtgtg
ggcgcaggactccacaaccttggcaacacctgctttctcaatgccaccatccagtgcttg
acctacacaccacctctagccaactacctgctctccaaggagcatgctcgcagctgccac
cagggaagcttctgcatgctgtgtgtcatgcagaaccacattgtccaggccttcgccaac
agcggcaacgccatcaagcccgtctccttcatccgagacctgaaaaagatcgcccgacac
ttccgctttgggaaccaggaggacgcgcatgagttcctgcggtacaccatcgacgccatg
cagaaagcctgcctgaatggctgtgccaagttggatcgtcaaacgcaggctactaccttg
gtccatcaaatttttggagggtatctcagatcacgcgtgaagtgctccgtgtgcaagagc
gtctcggacacctacgacccctacttggacgtcgcgctggagatccggcaagctgcgaat
attgtgcgtgctctggaactttttgtgaaagcagatgtcctgagtggagagaatgcctac
atgtgtgctaaatgcaagaagaaggttccagccagcaagcgcttcaccatccacagaaca
tccaacgtcttaaccctttccctcaagcgctttgccaacttcagcggggggaagatcacc
aaggatgtaggctatccggaattcctcaacatacgtccgtatatgtcccagaataatggt
gatcctgtcatgtatggactctatgctgtcctggtgcactcgggctacagctgccatgcc
gggcactattactgctacgtgaaggcaagcaatggacagtggtaccagatgaatgattcc
ttggtccattccagcaacgtcaaggtggttctgaaccagcaggcctacgtgctgttctat
ctgcgaattccaggctctaagaaaagtcccgagggcctcatctccaggacaggctcctcc
tcccttcccggccgcccgagtgtgattccagatcactccaagaagaacatcggcaacggg
attatttcctccccactgactggaaagcgacaagactctgggatgatgaagaagccgcac
atcactgaagagattggtgtgcccatatcccggaatggctccaccctgggcctgaagtcc
cagaacggctgtattcctccaaagctgccctcggggtccccttcccccaaactctcccag
acacccacacacatgccaaccatcctagacgaccctggaaagaaggtgaagaagccagct
cctccacagcacttttcccccagaactgctcaggagctgcctgggaccagcaactcgaat
agcagcagatctgggagtcaaaggcagggctcctgggacagcagggatgttgtcctctct
acctcacctaagctcctggctacagccactgccaacgggcatgggctgaaggggaacgac
gagagcgctggcctcgacaggaggggctccagcagctccagcccagagcactcggccagc
agcgactccaccaaggccccccagacccccaggagtggagcggcccatctctgcggttct
caggaaacaaactgttccaccgctggcccctccaaaacaccgccaagtggagcagattct
aagacggtgaagctgaagtcccctgtcctgagcaacaccaccactgagcctgcaagcacc
atgtctcctccaccagccaaaaaactggccctttctgccaagaaggccagcaccctgtgg
agggcgaccggcaatgacctccgtccacctcccccctcaccatcctccgacctcacccac
cccatgaaaacctctcaccccgtcgttgcctccacttggcccgtccatagagccagggct
gtgtcacctgctccccaatcatccagccgcctgcaaccccccttcagcccccaccccaca
ttgctgtccagtacccccaagcccccagggacgtcagaaccacggagctgctcctccatc
tcgacggcgctgcctcaggtcaacgaggacctcgtgtcccttccacaccagttgccagag
gccagtgagcccccccggagcccctctgagaagaggaagaagacctttgtgggagagctg
cagaggctgggctcagagacgcgcctcccacagcacatcagggaggccactgcagctccc
cacgggaagaggaagaggaagaagaagaagcgcccggaggacacagctgccagcgccctg
caggaggggcagacacagagacagcctgggagccccacgcacaggagggagggccaggca
cagctgcctgctgtcagacggcaggaagatggcacacagccacaggtgaatggccagcag
gtgggatgtgttacggacggccaccacgcgagcagcaggaagcggaggaggaaaggagca
gaaggtcttggtgaagaaggcggcctgcaccaggacccaccttggcacagctgctctccc
atgggtgatggtgatccagaggccatggaagagtctccaaggaaaaagaaaaagaaaaaa
agaaagcaggagccacaggaatccaccacaggtccggactggatgccagatgtcggcggt
cagtcagatgctatgaagacagcagacagcccgactgagaccgaaaagaaaattaaaaaa
tttaagagagagaagaggagaaacttcaacgccttccagaaacttcagactcgacggaac
ttctggtctgtgactcacccagcaaaggctgccagcctcagctatcgccgctga

DBGET integrated database retrieval system